SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025722 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025722
Domain Number 1 Region: 66-232
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-30
Family Canonical RBD 0.0053
Further Details:      
 
Domain Number 2 Region: 237-320
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-22
Family Canonical RBD 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025722   Gene: ENSMODG00000020561   Transcript: ENSMODT00000026180
Sequence length 583
Comment pep:novel chromosome:BROADO5:X:23545515:23547266:1 gene:ENSMODG00000020561 transcript:ENSMODT00000026180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADSATKMSNDSTNAAAAKAPEGVAGAPNEAALLALMERTGYSMTQENGQRKYGGPPPG
WEGLHPPRGCEVFVGKIPRDVYEDELVPVFESVGRIYQMRLMMDFDGKNRGYAFVMYTHK
REAKRAVRELDNHEIRPGRPLGVCCSVDNCRLFIGGIPKMKKRDEILEEISKVTEGVLDV
IVYASATDKTKNRGFAFIEYESHRAAAMARRKLMPGRIQLWGQQIAVDWAEPEMDVDEDV
METVKILYVRNLMIKTSEETIRKTFSQFGCVERVKKIRDYAFVHFTSREDAIRAMNSLNG
TELEGSCLGVTLAKPVDKEQYARYRKAVKGSVTAEVQQLNYVYSCDPYTLAYYSYPYSAL
FGPNRDYFVKAESVRGRGQDTAGSRAPGPRGSYFGGYSAGRGIYSRYHEGKGKWRERGYE
FVPNLELSAANPVPIKPGTVAIPALGAQYSMFQAGPAPKLLEDGKMHAMEHMINPIAVQA
DPAGASAAAAAATIPAGSTPPPFQARPITPVFTGAPNVQRIPAAGLYGAGYIPFAAPASA
TSATVQKSAAATAPVYGGYGGYIPQPFPSATIQPPIHEDYQTY
Download sequence
Identical sequences F7APN8
ENSMODP00000025722 ENSMODP00000025722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]