SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025797 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025797
Domain Number 1 Region: 242-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-80
Family Protein kinases, catalytic subunit 0.0000000228
Further Details:      
 
Domain Number 2 Region: 143-289
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-35
Family SH2 domain 0.0000358
Further Details:      
 
Domain Number 3 Region: 84-164
Classification Level Classification E-value
Superfamily SH3-domain 8.79e-19
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025797   Gene: ENSMODG00000020625   Transcript: ENSMODT00000026258
Sequence length 525
Comment pep:known_by_projection chromosome:BROADO5:5:175002455:175079115:1 gene:ENSMODG00000020625 transcript:ENSMODT00000026258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMILSTYNTIQSIFCCCCAVQKRQVRTQLSLNNGGESEEYSWCPKQLSHTSTHKNRSNRG
QVQQSRRKPLPPLPPEEENGEKIQVMALYDFLPREPCNLALKKSEEYLILEKYNLHWWKA
RDRRGNEGLIPSNYVTEYKLTNLEIYEWYHKNITRNQAEDLLRQQSKEGAFIVRDSRRLG
AYTISVYTRIRRSDEIPIKHYKIRNHDSGQCYVTERHLFPSIPELIQYHQHNAAGLMTRL
RYPVSSMGNCVPATAGFSYEKWEIDPSELTFIKELGKGQFGVVHLGKWRSHISVAIKAIN
QGAMSEDDFFEEAKVMTKLSHPRLVQLYGVCIQQKPLYIVTEFMENGSLLHFLRQKQGRI
GKEMLLSICQDVCEGMEYLERSSFIHRDLAARNCLVSSTGIVKISDFGMTRFVLDDEYIS
SSGAKFPVKWSAPEVFHFNKYSSKSDVWSFGILMWEVFSEGKMPFAKESNLQVMEAISKG
FRLYRPQLASMTVYEVMYSCWHEKPKGRPTFAELTQALSDIAETG
Download sequence
Identical sequences F6ZAP5
ENSMODP00000025797 ENSMODP00000025797 XP_001372180.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]