SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025802 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025802
Domain Number 1 Region: 83-298
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 337-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.49e-41
Family BAR domain 0.0044
Further Details:      
 
Domain Number 3 Region: 673-731
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-16
Family SH3-domain 0.0003
Further Details:      
 
Domain Number 4 Region: 574-655
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025802   Gene: ENSMODG00000020629   Transcript: ENSMODT00000026263
Sequence length 737
Comment pep:known_by_projection chromosome:BROADO5:5:43095393:43234592:-1 gene:ENSMODG00000020629 transcript:ENSMODT00000026263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKEASGKENMGTKKKNLTFLRQRLYMLERRKTDTVVESPGTVDHSNSGPLRRSQSDRT
EYNQKLQEKMTPQAGASAPGPTAHDEQQQIRRMMAKRSNIIKELIQTEKDYLNDLEMCIR
EVVQPLKNKQIDRFDADGLFSNIQSVHQISAKLLALLEEATMDVEPAMQGIGGVFLQIKS
PLEDIYKIYCYHHDEAHTMLESYEKDEELKQHMRHCIQSLKKIYLEEGKPNLLDMGSLLI
KPVQRVMKYPLLLCELRNSTPPSHPDYKALGDALAAVKDINVNINELKRRKDLVLKYKKN
DEDESFKDKFSKLNIHSISKKSKRVTNHLKILTRGDSQVVKDSTFNREEKLFRHLEKTVR
NCVKNISFCLQHIQDAMPLAAQTVTELHDISYDKDAKGTDYSATLSKAPSCCEDFVAHLH
RQVMTPLSSLQSLFPGPQKLIQKRYDKLLDYNGYLQRSAGDDSDLARKDYEALNAQLVEE
LQVFNQTGRQILFNCLYCFITLLRDLMLMALKPYSTVMPLSLLPSSISEVQNRVIEDVHS
LNFVKDNSATYIERKLSFEKKKPVPTLSEMPRQTDNHRSQLLAASSPEALYQAKRRCNAT
QEHDIDLLEGDLVTVMEQKDPLGSTSRWLVDTGIAKGYVYSSFLKPYNPAKMQQAEGEHR
FSDRADTDSLQDMDEQIFYAVHAFQARSEHELSLQEYQRVHILRFCDLSGNKEWWLAEAQ
GQKGYVPANYLGKMTYA
Download sequence
Identical sequences F7F3Z6
ENSMODP00000025802 ENSMODP00000025802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]