SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025804 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025804
Domain Number 1 Region: 375-636
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-79
Family Protein kinases, catalytic subunit 0.0000000201
Further Details:      
 
Domain Number 2 Region: 22-164
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-45
Family Pleckstrin-homology domain (PH domain) 0.0000288
Further Details:      
 
Domain Number 3 Region: 232-363
Classification Level Classification E-value
Superfamily SH2 domain 3.52e-29
Family SH2 domain 0.0000306
Further Details:      
 
Domain Number 4 Region: 186-253
Classification Level Classification E-value
Superfamily SH3-domain 4.49e-18
Family SH3-domain 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025804   Gene: ENSMODG00000020628   Transcript: ENSMODT00000026265
Sequence length 648
Comment pep:known_by_projection chromosome:BROADO5:5:174856735:174988899:1 gene:ENSMODG00000020628 transcript:ENSMODT00000026265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDWIFNGRKKKSNQMTEMNHNILLEEILIKRSQQKKKTSPLNYKERLFVLTKSLLSYYE
GRAEKKYRKGFIDISKIKCVEIVKIDDGIIPCQNKFPFQVVHDSITLYIFAPSAQSRDRW
VKSLKEEIKHNNNIMVKYHPKLWADGSYQCCRQTEKLAPGCEKYNLFESSIKKALPPAPE
KNKRRPPPPLPPEEDKNEEIVVAMYDFQATETHDLKLERGQEYIILEKNDVHWWRARDKH
GSEGYIPSNYVTGKKSSNLDQYEWYCRNMNRSKAEQLLKSEDKEGGFIVRDSSQAGMYTV
SLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFSSIPEIIEYHKHNAAGLVTRLRY
PVSAKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREG
AMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQRPIYIVTEFMECGCLLNFLRQRHGHFSR
DILLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNESGVVKVSDFGMARYVLDDQYTSSS
GAKFPVKWCPPEVFNYCRFSSKSDVWSFGVLMWEIFTEGRMPFEKNANFEVVTMVSRGHR
LYRPKLASRYVYEVMLSCWHEKPEGRPSFEELLRSIDELAECEEPFGR
Download sequence
Identical sequences F7EN79
ENSMODP00000025804 XP_007496542.1.35504 ENSMODP00000025804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]