SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025968 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025968
Domain Number 1 Region: 2175-2471
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000022
Further Details:      
 
Domain Number 2 Region: 1360-1466
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-28
Family PDZ domain 0.0000384
Further Details:      
 
Domain Number 3 Region: 786-891
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 4 Region: 1085-1194
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 674-784
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-25
Family Second domain of FERM 0.00053
Further Details:      
 
Domain Number 6 Region: 1786-1873
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-21
Family PDZ domain 0.021
Further Details:      
 
Domain Number 7 Region: 1495-1598
Classification Level Classification E-value
Superfamily PDZ domain-like 1.13e-20
Family PDZ domain 0.063
Further Details:      
 
Domain Number 8 Region: 581-673
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000258
Family First domain of FERM 0.012
Further Details:      
 
Domain Number 9 Region: 1892-1964
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000539
Family PDZ domain 0.047
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025968
Domain Number - Region: 2-162
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000179
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025968   Gene: ENSMODG00000020762   Transcript: ENSMODT00000026433
Sequence length 2485
Comment pep:known_by_projection chromosome:BROADO5:5:54505311:54732836:-1 gene:ENSMODG00000020762 transcript:ENSMODT00000026433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLSQSAESLQELFRKVNTTDPTALGFIISPWSLLLLP
SGNVSFTDESVSHQDLRAFTAPEILQNQSLNSFSDVEKIHIYSLGMTLYWGADHAVPQTQ
PIKLGDHLNSILLGMCEDVIYARVSIRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGSL
SGMDQPPCNNEQKLRPDRSQALRDRLRGKGLPTGRSSTSEVLAVSKTPFSQQSFLNKGLS
KSMGFLSIRDTPGEEDFFKEISSDYNPGYEESEGPCSLYHYKTNGTERKGNLSHNVLHKQ
KVWASSLDLVCSSDNPTNEDVLSAEAGRLRHCLPEAIKPQVSTAPRRKEARYSDGSLALD
IFGPQRLVPVRHIPELPTSPAISSALDRIRGRQKKLQVLREAMNIEEPIRRYKAYHSDIY
SSTSESPSIISSEPDFRQVRRSEASKTFDSSSGLQGVDETSSNLGQSQRLSRQYEKSFEG
NLISQEIMLKRQEEELMQLQTRMALRQSRLSLFPGDSIKASMLDVTRDPLREMALETAMT
QRKLRNFFGPEFVKMTVEPFISLDLPRSILTKKGKNEDTRRKINIMLLSGQRLELTCDIK
TLCKDVFDLVVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKNKTT
VNFTLFLRIKFFLDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEY
GDYQPEVAFLFFYWLKFRETASDVFLERRDLSYVKEELLNLHNTYVGASEKETEIEFLKV
CQRLTEYGVHFHRVHPEKKSQTGILLGICSKGVLVFEVHNGIRTLVLRFPWRETRKISFS
KKKITLQNTSDEIKHTFQTSNGKVCQYLLHLCSCQHKFQMQMRTRQSNQDALDIERASFR
SLNFQGDSVRGYTIGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQGS
SKERSEKTSWEERPSGISKSYHDLSQVSLYPHPKSIIDNVDSPPQSNEELVGKPSHQVPR
PEPESVAGFTKLNNSKSVASLNRSLERRKHESDSSSVEDTGQAYVVGISSGNGLSQSSLK
ENDVLQKRWSIVSSPEREITLVNLKKDNKYDLGFQIVGGEKTGRLDLGVFISSVTPGGPA
DLDGSLKPGDRLISVNSMSLEGVGYNAALEILQNAPEDVTLVISKPKEISQVPSTPTYLS
NRMKNYVPRPSSIKDNDLESSLEDHHQTHCYQRRISYCSSALSGGQNEGSLSSQDSRTES
ASLSQSHLNGFLINHLGAPAQHEFQQSSPSSLAMSKVTEKKQTLNDHNQSKPKKFGISET
MDYSDRGDSDMDEATYSSSQDHLNKKEPSSMSTSTKMNLKKNSSAPPKPGDIFEVELSKN
DNSLGISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLSVNGVSLEGTTHKQA
VEALRNTGQVVHLLLEKGHPSTTKVHAPITPQSTLLEQASLEKPMKKTTNTGDYNFVTEE
NTFEVKLLKNSSGLGFSFSREDNLIPEQMNASVVRVKKLFPGQPAAESGQIDVGDVIVKV
NGASLKGLSQQDVISVLRGTSPEVSLLLCRPPPGILPEIDASVLTPLYSPVQVFPDSNKE
THQPSHGDHGTSSDENEMSDKSKKLFHSLSRRDSYGYSSGSGEEDLALPPDQLANTDWNS
ASHQTLSSVISPENSQYEASGQESVTSTIFYYPQEPASRPNKEDSNPPSPLPVDVALLQG
CRIQLENVSSSSVDNNYTHQTSELITQEDTACLENSLDKQLEDYEPEVELHIILTKSDKG
SLGFTVTKGSESVGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHTDAVTLLRAA
PKTVSLVLGRILELPKIPILPHLLPDITLISLSLSGGHDSIYQVIYISDIHPKSTAAIES
DLQPLDIIHYVNGMSTHGMTLKEAQRILEMSFPTVVLKATRDGHPVVPKSKGYSSSNSRS
ITSNGHHHGSHCGQPALTSDNSYPKTNGERVTEDSFLEATNCISQNKSSVNLIMSRETPA
VQEDINYEDDPQEDEVIQSLLDVVDEEAQNLLNCNNAIAGDLWMLETFRNLAEEKAEDTD
CDGYSLPEDFPESTKADTSEDFCEDKVLNERQVSHISRKKDNEDEVWESNKLPNETINQG
DLSKGKIVYHPFLTNKELSALPVVKVLPSGIYTGNKLKCVIRMLRGLLDQGVPSKELENL
QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGAYINASFIKMPVGNKEFVYI
ACQGPLPTTVADFWQMIWEQNATVIAMMTQEVEGEKIKCQRYWPDILGKTIMVNDRLRLA
LVRVQQLKGFIVRAMELQDIQTGEVRCISHLNFTAWPDHDTPSQPDDLLMFISYMRHVHK
SGPIIIHCSAGIGRSGTLICIDVVLGLINQDLEFDISDLVRTMRLQRHGMIQTEDQYIFC
YQVVLCVLRRLQVEEEQKNRQQNLK
Download sequence
Identical sequences F6ZYU4
ENSMODP00000025968 ENSMODP00000025968 13616.ENSMODP00000025968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]