SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026104 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026104
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000964
Family Canonical RBD 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026104   Gene: ENSMODG00000020877   Transcript: ENSMODT00000026569
Sequence length 1167
Comment pep:known_by_projection chromosome:BROADO5:Un:13962725:13982066:-1 gene:ENSMODG00000020877 transcript:ENSMODT00000026569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGGERRLFVGGLGPTVTQDDVRAQLSRFGAVSSVELVSRVDVLGNPEKTFAYVNVAL
SEAALQRCLSALNKTAWKGGTLQVQLAKESFLHRLAKERQQAKAKQEQQFSDGPTAGSET
SLGKNGILEFHMKAVPGTEVPGHKDWVVSKFGRVLPVLHLRSQNKRKILKYDPSKYCHNL
KKFEQDVTNTVSISDLTWKLEGGDDTMSKKRQGQFPAFRNCPPKRAKVGGNHCSPAPPNV
AQQPDVQKADLSPVELPTSGSSRHKNSQKPETVFLPASKSPFVRSRNTMSDDDIDSEDEL
KAMIAEEKKSQKMVFETDSTERDSFEVVSSDFKPSPASSGVKHKRTQASCSNSSHPAESD
KEYDSGDTDEIIAGGKNGDQSKNKAKTSPKRKAKPKEKKDCLQNRTDHPSSGHATEIRKG
RHSSGNEKESSTKLATKKLPCTPPESEDGSEENLDYDSMMTNCYRLDLTLADLEKLASEG
VQKAEDSDDCTEQDLPRRQVPDFSQKKRKASNRRAQCINPSDILASLLEGEEISDRKPPQ
ENMWKSKFQAFKGVGALYEGETLRKPFRDTGGFAHKKGHSWNQEASANSVGKQAFGSNTC
SSEEMFPPQDGRETNEVDGLAHCPGKAPRKRQASRDQCSTGQSSTPGSECENGSVSSLSS
LDTKKTHRTDLGSDAGMRKPKQGKSDSLPLRPSPGQEPKPVVLKTHAKKPIQVSVERVSA
FSRMQGKAPRGSQEETNCPPPQIPSSDAISPPKNSQDNQKRLAALEERKRERELQKQLVR
SALSSVDSSLASKPTHIVFGSDSEEETEEKGGSEQPLPENRVKQDLTGKTSGKLFESSED
DEQESDDDEARFQIKPQFEGKAGKKLMNLQSHFGTDDRFRMDARFLESESEEEEEAEEPK
KAETNEEAELIAEKKKNLDMIQNLLHIGHPTPKLSKEEMAAKQFRNIVRYDPTRLDHATF
ERKTDPEEKESKARRRKKREEAEKLPEVSKDLYHSIAADLKDRFRATEPAPGGTGATGPW
NETPEELETTEAPSAGLSEFTFSFFGPDSNGAKEEPYKIEARAPGRMAWQQDPRFQDSSS
EEEEEEEVEPDDGSREAAGTGEVPLPEKPARRFFFFSENDERLGVGPESFWQGSGSRASS
EDWESRTMVLLQDCRKKHKAAKRKAKP
Download sequence
Identical sequences H9H7P4
XP_007505872.1.35504 ENSMODP00000026104 ENSMODP00000026104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]