SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026121 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026121
Domain Number 1 Region: 4031-4387
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.5e-131
Family Hect, E3 ligase catalytic domain 0.0000000312
Further Details:      
 
Domain Number 2 Region: 1661-1724
Classification Level Classification E-value
Superfamily WWE domain 2.09e-17
Family WWE domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1348-1402
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000652
Family UBA domain 0.0059
Further Details:      
 
Domain Number 4 Region: 80-168,230-433,569-732
Classification Level Classification E-value
Superfamily ARM repeat 0.0000151
Family Plakophilin 1 helical region 0.099
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026121
Domain Number - Region: 1499-1614,1803-1875,2156-2238
Classification Level Classification E-value
Superfamily ARM repeat 0.00257
Family Armadillo repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026121   Gene: ENSMODG00000020890   Transcript: ENSMODT00000026586
Sequence length 4394
Comment pep:known_by_projection chromosome:BROADO5:Un:23502348:23612745:-1 gene:ENSMODG00000020890 transcript:ENSMODT00000026586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRTKLKKTPTEAPADCRALIDKLKGCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMAWMLMCDGPDKEHLKLLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLSRLQHLAESWGGKENGFGLA
ECCRDLHMLKYPPSATTLHFEFYADPGAEVKVEKRTPSNTLHYIHIEQLDKISESPSEIM
ESLTKMYNIPKDKQMLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMDIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPIMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTAHEGEEMETDTDVADVAMESSPGPSTASVDHRPDVETRSRAPSISGSVMLPPRTGV
QCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISNAEYYGPSLFLLA
TEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGL
QSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLGSAVDELMRHQPTLKTDAT
TAIIKLLEEICNLGRDPKYICQKPSIQKADGTSSATPQRANHAAEEASSEDEEEEEVQAM
QSFNPPAQSDNDSNQQVVGTEERVPIPLMDYILNVMKFVESILSNNTTDDHCQEFVNQKG
LLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQEGLLQLDSILSSLEPL
HRPIEAPGGSVLLRELACAGNVADATLSAQATPLLHALTAAHAYIMMFVHTCRVGQSEIR
AISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSLPSGCEFGQADMQKLVPKE
EKAAATTTSHGTKRTEGESDGTTATVEASAQGLLEGIGLDGDTLAPMETDEPSTSDPKGK
SKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVRQRRSHHATSTTTAPT
PAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSPMLFDERKYPYHLMLQ
KFLCSGGHNALFETFNWALSMGGKVPVSEGLEHPDLPDGTGEFLDAWLMLVEKMVNPTTV
LESPHSLPAKLPGGQSHPQFSALRFLVVTQKAAFTCIKNLWNRKPLKVYGGRMAESMLAI
LCHILRGEPVIRERLSKDKEGTRGEEEAGQEESGSRRDPQVNQQQLQQLMDMGFTREHAM
EALLNTSTMEQATEYLLTHPPPLMGGVVRDLSMSEEDQMMRAIAMSLGQDIPMDQRAESP
EEAACRKEEEERKAREKQEEEEAKCLEKFQDAEPLEQEELHSFTDTMLPGCFHLLDELPD
TVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAALPLTTSDTKTVSEWISQ
MVTLPQASNLATRILLLTLLFEELKLPCARVVESSGILNVLIKLLEVVQPCLQAAKEQKE
IHTPKWITPVLLLIDFYEKTAISSKRRAQMNKFLQANNNNWRWFDDRSGRWCSYSASNNS
TIDAAWKAGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNPKDGN
EQELDKTLDETKEVDAKSAEEKTSSECPLAPESPTLEKELVPEEAQLGEILIQGLTEEMV
TVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYALMFAELKSTRMILNLTQSSGFNG
FTPLVTLLLRHIIEDPCTLQHTMEKVVRSAATSGAGSTTSGVVSGSLGSREINYILRVLG
PAACRNPDIFTEVANGCIRIALPAPRGSGTASDDEFENLRIKGPNAVQLVKTTPVKPSAL
PLIPDTIKEVIYDMLNALAAYHAPDEDKSDPKAGVMTQEVSQILQDMGDEVYQQYRSLTR
QGSDFDAQTGFAINTQVFATDGTSTETPQSGTPQGGASTPEESREGKKDKEGERVSEEGK
QKAKGSKPLMPTSTILRLLAELVRSYVGIATLIANYNYAVGQSELIKEDCSVLAFVLDHL
LPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAALSRALAMAESTEKHARL
QAVMCIISTIMESCPSTSSFYSSTTAKTQHNGMNNIIRLFLKKGLVNDLARVPHSLDLSS
PNMANTVNAALKPLETLSRIVNQPSSLFGSKSASGKSKSEQDAQGASQDANSNTQDPGET
GEAEVQEEDHDATQTEVADGDIMDGEAENDAVVIAGQPQVLSTQEMQVENELEDLIDELL
ERDGGSGNSTIIVGRSGEDESQEDVLMDEAPSNLSQASTLQANREDSMNLLDAEDEEEHT
QEEDSSGSNEDEDESQDEEEEEEEDEEDDQDDEEGEEGDEDDDDDGSEMELDEDYPDMNA
SPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPLMVRHADHSSLTLGSGSST
TRLTQGMGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSL
PLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECK
VLDAESMHDCVSVVKVPIINHLEALRDEELEERREKRRQQLADGESKAKEEKESKDQSTQ
DSTSKSDTSTSQNVSDQSPGLDSYPTTPSSAEGTSARPKQTLVTLETSQQPPPAASSSLD
QELPGPAPASEAAAQPLMPAEHEDLGPGRANGETEATQMEFSPAPTITSLSPERAEDSDA
LTAVSSQLEGSPMDTSSLASCNLEEGVGDSTVASNVDAPGPAPTTPGDPAQAGTETQGSS
DGPGDSPGESPQQAEDSSPPGSSSESSSTRDSAVAISGADSRGLLEEPLPSTSSEEEDPL
AGINLPEGVDPSFLAALPDDIRREVLQNQLGIRPPARVTPAATTPTPPPVVGNPSVTEVS
PEFLAALPPAIQEEVLAQQRAEQQRRELAQSASSDTPMDPVTFIQTLPSDLRRSVLEDME
DSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHSSTSALSAILRSPAFTSRLSGNR
GVQYTRLAVQRGGTFQMSGSSSHTRPSGSNVDSLLRLRGRLLLDHEALSCLLVLLFVDEP
KLNTSRLHRVLRNLCYHGQTRLWVIRSLLSILQRSSESELCIETPKVTTTEEKGKKAAKS
CPTGSHDSRPLDLLHKMESKSSSQLSWLSVSMDAALGCRTNIFQIQRAVGRKHTEKHAGC
GSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTKETNCESDRERSNKQACSPCPG
QSTSSGISTDFWDLLVKLDNMNVSRKGKNSVKSVPVNVGSEGETSLYSLEASPLGQLMNM
LSHPVIRRSSLLTEKLLRLLSLISIALPENKAPETPSTTTASSTSATTTNTIVTTPGPLT
PGPTPTGVSATATLATTPTSTPTAVTTTAKISKSPAKANEGGSGGSVDCKMAASGLTENQ
LQLSVEVLTSHSCSEEGLEDAANVLLQLSRGDPTTRDTVLKLLLNGARHLGYTLCKQIGT
LLAELREYNLEQQRRAQCEILSPDGLPEEQPQATRSKGKMQSRFDTAENVVIVASQKRPL
GGRELQLPSMSMLTSKTSTQKFFLRVLQVIIQLRDDTRRANKKAKQTSRLGTSSLGSASS
IQAAVRQLEAEADAIIQMVREGQRARRQQQAATSDSSQSEIASRRDESPMDVDQPSPASQ
DTQSIGSEGSQQSEKEKEERPPDLPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQ
PAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSREPS
SMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKY
FRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGG
LLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYD
NRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQE
FGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLIS
IFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFV
TGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESYEKLRHML
LLAIQECSEGFGLA
Download sequence
Identical sequences H9H7Q4
ENSMODP00000026121 XP_016282621.1.35504 ENSMODP00000026121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]