SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026126 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026126
Domain Number 1 Region: 250-458
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.14e-55
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 442-572
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-29
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 3 Region: 703-799
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-21
Family Pleckstrin-homology domain (PH domain) 0.00079
Further Details:      
 
Domain Number 4 Region: 602-669
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026126   Gene: ENSMODG00000020895   Transcript: ENSMODT00000026591
Sequence length 848
Comment pep:known_by_projection chromosome:BROADO5:Un:23741963:23752157:-1 gene:ENSMODG00000020895 transcript:ENSMODT00000026591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFQWDLLLVAGMLPGPRLLIKSLSLEPSPEGSPSETQSLTASPSRRPPGPKPQVPPKPA
HLLGPRLAPLLEPIPPPPSRPLPADPRLTRASQARPEVAGGGSALTSLIERFEREPAVLA
PEVAVATGLGPSELTTGADSREGSPCLLLSAPGEKVPNRDSGIGSISSPSTSEETCLANA
SSSGNGGGGGEAAPGPPSGLFPAGGPLQPPQDTVEADSDLDEDEEEDDEEGREGLPRPRM
ERQDSSELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARTRSSFPADVVHG
IFSNICSIYCFHQQFLLPELEKRMEEWDQHPRIGDILQKLAPFLKMYGEYVKNFDRAVEL
VNTWTERSAPFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPD
SKDAEKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPANELIKEGHILKL
SAKNGTTQDRYLILFNDRLLYCVPKLRLLGQKFSVRACIDVDGLELKESSNLNLPRTFLV
SGKQRSLELQARTEEEKKDWIQAIHATLLKHERTLETFKLFNSAHREEEETPPSSPNMDL
GKRAPTPIREKEVTMCMCCQEPFNPITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNR
VCLDCYTALRGTQGPSPTPGQNTPQRRRSILEKQASVAAENSLVCSFMHYMEKGAKGWHK
AWFVVPESEPLVLYIYGAPQDVKAQRSLPLIGFEVGAPEANEHKERRHVFKISQSHLAWY
FSPESEELQRRWMDVLARAGRGDELRAGPSILEAGEEDETAAVAAAAAAAAAAAAAAAGP
GLESAAKT
Download sequence
Identical sequences H9H7Q9
XP_007506068.1.35504 ENSMODP00000026126 ENSMODP00000026126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]