SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026210 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026210
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily UBA-like 9.25e-29
Family UBA domain 0.00011
Further Details:      
 
Domain Number 2 Region: 157-217
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000314
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026210   Gene: ENSMODG00000020954   Transcript: ENSMODT00000026676
Sequence length 443
Comment pep:novel chromosome:BROADO5:4:784240:922451:1 gene:ENSMODG00000020954 transcript:ENSMODT00000026676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEQNVLQQSTSQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEEATYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRET
GITDEEQAISRVLEASIAENKASLKRTHTEVWNDSPNPHDRKRQDNCPVGLKNVGNTCWF
SAVIQTRTVMVNLLEKECRVLPPPHTPDRGLNQRQETSLFRVLKYLYSHVRKRCRGCASP
SLAVLNVSSSSLQKWHQDYRSFRDTTAYLTVGLEHFQTKSYVEAILYLICAYQHNKELLS
KGPYRGHDEELLSHYRRECLLKLNEHAAELFESGDDQEVNNGLIIMNELIVPCLPLLLVD
EMEEKDIVAVEDMRNRWCSYLGQEMESRLQEKLTDFLPKLLDCSTEMKGFSEPPKLPPCS
THELCERFARIMLSLSRTPADGR
Download sequence
Identical sequences F6SNZ3
ENSMODP00000026210 ENSMODP00000026210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]