SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026277 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026277
Domain Number 1 Region: 330-438
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.08e-46
Family ets domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 177-269
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4e-28
Family Pointed domain 0.000016
Further Details:      
 
Domain Number 3 Region: 56-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000168
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026277   Gene: ENSMODG00000021010   Transcript: ENSMODT00000026745
Sequence length 474
Comment pep:known_by_projection chromosome:BROADO5:4:7467232:7534928:-1 gene:ENSMODG00000021010 transcript:ENSMODT00000026745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKIEAGRSKVTCQGYTATMTKREAEELIEIEIDGTEKQECTEESIVEQTYTPAECVSQAI
DINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQ
GIEPKLNILEIVKPAETVEVVIDPDVHHAEAEAHLVEEAQVITLDGTKHIATISDETSEQ
VTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLPTLSISGREL
CSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQHMGEIATVTIDQPVQIIPASVQPNT
PTTIKVINSSAKTAKVQRAPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCIS
WVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFV
CDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Download sequence
Identical sequences F6QZT8
ENSMODP00000026277 ENSMODP00000026277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]