SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026289 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026289
Domain Number 1 Region: 359-372,403-595
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 5.95e-32
Family Cofactor-dependent phosphoglycerate mutase 0.013
Further Details:      
 
Domain Number 2 Region: 240-305
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000134
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 23-72
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000214
Family UBA domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026289
Domain Number - Region: 78-135
Classification Level Classification E-value
Superfamily LigT-like 0.00837
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026289   Gene: ENSMODG00000021021   Transcript: ENSMODT00000026757
Sequence length 620
Comment pep:known_by_projection chromosome:BROADO5:4:8551246:8685411:1 gene:ENSMODG00000021021 transcript:ENSMODT00000026757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKETQLYTKIAKKLKDQTTLPLLEPLLAMGFPAHMAQKALAATGRRTVEEASEWLHFH
YNDPSLDDPIPQEYALYLCPTGPLLEKLQDFWRESKRQCGKNRAHETFPHVTLCDFFTCE
DQKVEYLYEALKRTGDKILSSFPSTIPLNLHSSISYLGFFISDSSADVIREFAMSFATEA
SILADCIVKPCTKQLHLTLAHKFCPHHQKTLEQLAKSIDQLHNCQWTAALYSRDMRFVHY
QTLRALFQYKPQNMDELMITAGDYIFVDRTQQAEASEGWVIGISHRTGCRGFVPENYTER
ANESDTWVKHRTYTFSLAIALDSKDREHDTTMNHKLQHSLMTAKTSKIQTWQGLTHRRSL
LVVRHGERVDQIFGKSWLQQCSTIDGKYYRPDMNFPSSLPERKNGLKNFENDPPLSSCGI
FQSRLTGEALLDSGIKINYMYCSPALRCIQTAKYILEELKQEKSLKIRVEPGLFEWTKWE
IGDTIPALMSLAELSRAKYNVDVDYRSEFPLSSLKTSESYDDYVKRCSMTVKQIVAACQG
GVISIISHGSALDSCTRPLLNLPPRDISDFAQLVRKIPSLGMCFCEEIEENKWQLNNPPV
KTLTHGSNSAFNWRNWIQDC
Download sequence
Identical sequences F6QZ99
ENSMODP00000026289 XP_007493239.1.35504 ENSMODP00000026289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]