SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026300 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026300
Domain Number 1 Region: 23-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-96
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026300
Domain Number - Region: 294-340
Classification Level Classification E-value
Superfamily UBA-like 0.0397
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026300   Gene: ENSMODG00000021031   Transcript: ENSMODT00000026768
Sequence length 780
Comment pep:novel chromosome:BROADO5:4:9616701:9630720:-1 gene:ENSMODG00000021031 transcript:ENSMODT00000026768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIMSEFTSVPISNQTQQRPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKA
RLDPSNLEKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHL
SENEARKKFWQILSAVEYCHSHHIVHRDLKTENLLLDASMNIKLADFGFGNFYKSGEPLS
TWCGSPPYAAPEVFEGKEYEGPHLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRF
RIPFYMSQDCETLIRRMLVVDPAKRITIAQIKHHKWMQADPSLPRSPGLAFSVHNYSSNL
GDYNEQVLGMMQTLGISKQRTVESLQNSSYNHFAAIYYLLLERLKEYRSTQPSTCSGPGE
LPRSRSSDPSPLETPPEGLAADAFRSSLLPQHPQSLAPAVLQEAMDFDLNHPLQPLFFSA
DPSVSGLLRNGFISPNSLLETTISEEVRQDQDLEEEVKAQHPGHPPSSTANRRHTLAEVT
SHLYQRSPPCIVISSCTSPAEGTSSDSCLTSSSSNGSGGLSSCLNGQVLMADSSDVKLAS
PFLVAQCDTPGQKLEGGLGRAALLPLSFQEGRRASDTSLTQGLKAFRQQLRKNTRAKGLL
GLNKINGLARQACQASSGRATRGCLNSSQHYQPNPCLYSSGGKGREGENLLEEVLHQQRL
LQLQHNTSVHLSCPQAPQLSQAQYVISACDESYPEANPLLTCGAHPHLFKGSVSPVSSAA
QLLDSPLGIHSHPSLATPSFPQQPHFAIWSPSYDPAVLHQGDYEMEDLTSPQVGKFVLVQ
Download sequence
Identical sequences F6W0L0
13616.ENSMODP00000026300 ENSMODP00000026300 ENSMODP00000026300 XP_001364783.1.35504 XP_016288633.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]