SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026309 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026309
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily ENTH/VHS domain 7.85e-30
Family RPR domain (SMART 00582 ) 0.0052
Further Details:      
 
Domain Number 2 Region: 425-552
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-18
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026309   Gene: ENSMODG00000021040   Transcript: ENSMODT00000026777
Sequence length 1081
Comment pep:known_by_projection chromosome:BROADO5:4:10626850:10738389:1 gene:ENSMODG00000021040 transcript:ENSMODT00000026777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKV
PGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKN
GVFKIEIIQPLLDMAAGATSAASVPENVTNNEGSPPPPIKVSSEPPQVTTNSVPTMPQLP
SSDAFAAVAQLFQTTQGQQLQQILQTFQQPSKPQSPAIDNSVMAQVQAITAQLKTTTTQP
PEQKASFPQPEQKTTFDKKLLDRFDYDDEPEAAEESKKEDSSVSPSLPQPPFGFPGDGMQ
QPAYSQLPNIDPYQQRMLGVQQDPIHHQVPLPPNGQMPGFGLLPTPPFPAMAPPVIPPTP
PVQQPFQTSFQPQNEPHMQKVHQQEMEVEQPCVQESKRHVSENRKSRSRSASRSPKRRRS
RSGSRSRRSRHRRSRSRSRERRRHSPRSRSQERRERERERERRQKGLPQIKPETASVCST
TLWVGQLDKRTTQQDVASLLEEFGPIESINMIPPRGCAYIVMVHRQDAYRALQKLSRGNY
KVNQKSIKIAWALNKGIKTDYKQYWDVELGVTYIPWDKVKPEDLESFCEGGMLDSETLNP
DWKGIPKKSDSEVAQNGGAETTHTEPVSPIPKALPVPVPPIPVPAPITVPPPQVPPHQPG
PPVVGALQPPTFTPPLGIPPPGFGHGVPPPPPPPFLRPGFNPMHLPPGFLPPGPPPPITP
PVSIPPPHTPPITIPNSTIAGINEDTTKDLSIGNPIPTVVSGARGNAESGDSVKMYGSAV
PPAAPPVTQPVSLLGTQGVAPGPVIGLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPL
MPPRPMPPHMMHRGPPPGPGGFGMPPPHGMKGPFPPHGPFVRPGGMPGLGGPGPGPGGAE
ERDGRPQQPPQQPPPQQPFRNETRQQQFNSGRDQERFGRRSFGNRVENDRERYGNRIDDR
DNSNRERREWGRRTPERDRHRDLEERRRSSGHRDRDSRERDSRRDKEENRGKEKPEVTDR
AGGDKTIEPSSSSQVGNADTISELDKGESTALNPTEELPSEATSSVDEPEKDSASGVEAS
R
Download sequence
Identical sequences F6W0D3
ENSMODP00000026309 ENSMODP00000026309 XP_007493279.1.35504 13616.ENSMODP00000026309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]