SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026318 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026318
Domain Number 1 Region: 68-324
Classification Level Classification E-value
Superfamily SET domain 2.49e-57
Family RuBisCo LSMT catalytic domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026318
Domain Number - Region: 317-465
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.000301
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026318   Gene: ENSMODG00000021048   Transcript: ENSMODT00000026786
Sequence length 469
Comment pep:known_by_projection chromosome:BROADO5:4:11194936:11229804:1 gene:ENSMODG00000021048 transcript:ENSMODT00000026786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLWGLFLFAARFPVSRVCKTLIRQLHGNYIYIMKKKGRGRTSRQRRRKSFRTSELSKESE
NHKQEFIELRKWLKKRKFEDHNLRPTRFSNTGRGLMAVKSLQPGELIISLPKECLLTTDT
VIRSYLGDYITKWMPPISPLLALCAFLISEKHAGNKSPWKPYLDVLPKAYTCLVCLEPEV
VRLLPRPLQMKAEEQRMQVQKLFISSRGFFSSLQSLFTEDVKHVFHYHAFLWAWCTINTR
TVYMKHAQKQCLSAEPDVYALAPYLDLLNHSPRVWVEAAFNEETCCYEIRTTSHCKKFEE
LFICYGPHDNHRLLLEYGFVASNNPHSAVYIAVDSLVDHLPSVDKQMNKKISLLKEHGFS
ENLTFGWDGPSWKLLTALKLLCLGPEEFTCWKKVLLGEVISDTNEQKSLVLSRQICSYFI
EETKTALHKISHMKNEQTALEYQLTLVENLWVEELRILQVSADILKNVH
Download sequence
Identical sequences F6VK30
ENSMODP00000026318 ENSMODP00000026318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]