SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026325 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026325
Domain Number 1 Region: 70-171
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.76e-27
Family Canonical RBD 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026325   Gene: ENSMODG00000021053   Transcript: ENSMODT00000026793
Sequence length 259
Comment pep:known_by_projection chromosome:BROADO5:4:12889133:13017047:1 gene:ENSMODG00000021053 transcript:ENSMODT00000026793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGVLEPQSGAIAAAASVEGEERREEAVPPGLGATQQHFSPFEGAEARDEGGGDWSFID
CEMEEIDLQDLPSAFIACNLDPRVFVDSLCRAKFESLFRTYDKDITFQYFKSFKRVRINF
SNPLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWK
QVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEGEGDEEADGAKK
PKPKIIQTRRPEYTPVHLG
Download sequence
Identical sequences F6VJK2
XP_001376480.2.35504 ENSMODP00000026325 ENSMODP00000026325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]