SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026351 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026351
Domain Number 1 Region: 515-811,842-888
Classification Level Classification E-value
Superfamily DNase I-like 1.31e-76
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000139
Further Details:      
 
Domain Number 2 Region: 883-971
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000281
Family Canonical RBD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026351   Gene: ENSMODG00000021073   Transcript: ENSMODT00000026820
Sequence length 1316
Comment pep:known_by_projection chromosome:BROADO5:4:15321138:15445380:1 gene:ENSMODG00000021073 transcript:ENSMODT00000026820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSKGFRIFQKLDPAPFSLLVEPRNKEECLLFESGAVAVLTFAEKMAIKNMYSKVLDAY
GLIGVLQLNLGDIMVQYLVLVTGCMSVGKIQESEVFRVISTEFISLRTDSSDEDRISEVR
KILNSGNFYFAWSATGTSLDLSLNACRGIQAYTTDERFFWNQSLHLHLKHYGVNCDDWLL
RLMCGGIEIRTIYAAHRQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQIIYLD
DAVSSFIQIRGSVPLFWEQPGIQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVN
LLGTKEGEDMLSKAFQSHLKASEHALDIEMVNFDYHQLVKGGKVEKLHSVLKPRVQKFLE
SGVFCFDGTAVTRSQDGTIRTNCLDCLDRTNSVQAFFGLEVLPKQLEALGLAEKPQLMTR
FLEVFRSMWSMNGDSISKIYAGTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDILL
LGSTLNSDLADKARALLTTGGLRVSEQTLQSASPKILKSMCENFYKYTEPKKIRVCIGTW
NVNGGKQFRSIAFKNQTLTDWLLETPVLTSIQELQDQRDKPTDIFAIGFEEMVELNAGNI
VSASTTNQKLWAVELQKILSRDRKYVLLASEQLVGICLYVFIRPQHAPFIRDVGFDTVKT
GMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFVEIARRLSFPMGRMLL
SHDYVFWCGDFNYRIDLPNEEVRELIKHQNWDSLIAGDQLINQKNAGQIFRGFLEGKITF
APTYKYDLFSDDYDTSEKCRTPAWTDRILWRRRKWPFDRSAEDLDLLNASFQDDSKVLYT
WNPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAKTRQIVYKEVIATQGPTDGTVLVTI
KRSSSENNFFDDSLINELLQEFGNHGEVILIRFVEDQMWVTFLEGSSALKVLNLNGKEFL
DRLISITLKNPNWIADLEKEINLEKISITVPPSASSTLLGEDAEVATDFVMEGDVDDESA
EVEEILPQHLQPTSSCGLGTSPSCSPRSSPCQSPTIADVLPPPLPARPTRSKTSTLPVSP
LPSQSKFPDSPSDTLPVITTKEAGFVLEPKRPPPPRPVAPPARPAPPQRPPPPSGNRSPA
PSRKEFGGLGGPPSPGVSKKDIAAPKSPGTIKKDSSGQNESFPQGGSVSPGTVGSSVAKP
AIPPRVGIISAPQTLSRATTGKIATEAPNKSSQAPKGSSLLPEPLKPQTVAPAPPSSSSS
IQKMQEPLIPMTSSIPQPTSQQTLEAPPQPPPRSRSSHNLPPESSSLQQQQEQPSG
Download sequence
Identical sequences F6V196
ENSMODP00000026351 ENSMODP00000026351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]