SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026633 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026633
Domain Number 1 Region: 699-1060
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.69e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000555
Further Details:      
 
Domain Number 2 Region: 519-696
Classification Level Classification E-value
Superfamily ARM repeat 1.92e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000249
Further Details:      
 
Domain Number 3 Region: 106-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-48
Family Ras-binding domain, RBD 0.00075
Further Details:      
 
Domain Number 4 Region: 331-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.13e-43
Family PLC-like (P variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026633   Gene: ENSMODG00000021305   Transcript: ENSMODT00000027109
Sequence length 1068
Comment pep:known_by_projection chromosome:BROADO5:7:202274767:202343395:1 gene:ENSMODG00000021305 transcript:ENSMODT00000027109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVHAPHSRALYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYTQLPLD
TFTMPSYSRRISTATPYMNGEASTKSLWVVNSALRIRILCATYVNVNIRDIDKIYVRTGI
CHGGEPLCDNVNTQRVPCSNPRWNEWLMYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SNPVKFPDMAVIEEHANWTVSRELGFNYSHAGLSNRIARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVSIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRAFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences F7G3I5
13616.ENSMODP00000026633 ENSMODP00000026633 XP_001362549.1.35504 XP_007502025.1.35504 XP_016280688.1.35504 XP_016280689.1.35504 ENSMODP00000026633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]