SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026683 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026683
Domain Number 1 Region: 207-323
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 6.28e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000344
Further Details:      
 
Domain Number 2 Region: 105-213
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.96e-22
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000377
Further Details:      
 
Domain Number 3 Region: 52-103
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000022
Family TS-N domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026683   Gene: ENSMODG00000021351   Transcript: ENSMODT00000027162
Sequence length 331
Comment pep:known_by_projection chromosome:BROADO5:Un:32058489:32073337:1 gene:ENSMODG00000021351 transcript:ENSMODT00000027162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSRVSRQLLPGLKNMSFFRSLRLFRDLGCRSRPVLLGSRLFGVGKPEVVSSKEHLQKLR
RKTGYSFTNCKKALENCGGDLTQAEAWLHKQAQKEGWSKATKLKGRKTKEGLIGLLQEGN
SAVMVEVNCETDFVSRNVKFQQLVQQVALGTMLYCQSLREQLSSYRKGFLETAELSQLRA
GPDREDSLKDQLTLFIGKLGENLTLKRAAWVTVPNGFYIGSYVHGAMHSPSLGNMVLGKY
GALVICQTTEKKQNLEDLGRRLGQHVVGMAPLSVGSMDDEPGGEEETKMLAQPYLLDPSI
TLGQYVKPQGVSVIDFLRFECGEDLRTTKTE
Download sequence
Identical sequences H9H7Z3
XP_001380760.1.35504 ENSMODP00000026683 ENSMODP00000026683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]