SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026834 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026834
Domain Number 1 Region: 264-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.72e-81
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 6.59e-40
Family SH2 domain 0.00000714
Further Details:      
 
Domain Number 3 Region: 76-161
Classification Level Classification E-value
Superfamily SH3-domain 2.94e-24
Family SH3-domain 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026834   Gene: ENSMODG00000021477   Transcript: ENSMODT00000027315
Sequence length 541
Comment pep:novel chromosome:BROADO5:3:265214079:265257872:-1 gene:ENSMODG00000021477 transcript:ENSMODT00000027315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVKSKEDKDPAMKYGTESSSEPISINVGHFGSELTLGCQSSSIKGSTVNFSSHSMAPF
GGSAGMTPFGGATSSFSSMPSPHSTGLTGGVTIFVALYDYEARTTEDLSFKKSERFQIIN
NTEGDWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAFSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAPFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGILLDFLKE
GDGKHLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDN
L
Download sequence
Identical sequences F7G374
ENSMODP00000026834 ENSMODP00000026834 13616.ENSMODP00000026834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]