SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027219 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027219
Domain Number 1 Region: 259-522
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.9e-81
Family STAT DNA-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 523-642
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-35
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 3 Region: 113-267
Classification Level Classification E-value
Superfamily STAT 2.16e-23
Family STAT 0.0056
Further Details:      
 
Domain Number 4 Region: 1-114
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 7.59e-20
Family Transcription factor STAT-4 N-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027219   Gene: ENSMODG00000019411   Transcript: ENSMODT00000028749
Sequence length 839
Comment pep:known_by_projection chromosome:BROADO5:Un:37023601:37044246:-1 gene:ENSMODG00000019411 transcript:ENSMODT00000028749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWSLVSKMPPEKFQGLFVQFPQHLRHLLGDWLENQPWEFLGGSDAFSCRIASTLLSET
VQQLKSAAGEQGEGRTTLQHISSLENLCQRDPLKLVSTFRQILQGEKVAVLEQFHHLPLA
FHWKQEELKFGVIVQRLQHHVGEIRALRETTGQACLQSMMEESANGTNSNEPLLRLLQET
IKELEGARALVLKKIQIWKRQQQLAGNGAPFDESLAPLQERCENLVDIYSQLQQEVGGAT
GELEPSIQAALNGRLDDVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGFRLLGTPT
KTPLVRADMVTEKQARELNHPQGSGAGVESTGEITNNTVPLENSIPGNCCSALFKNLLLK
KIKRCERKGTESVTEEKCAVLFSTSFTLGPNNLTFHLQALSLPLVVIVHGNQDNNAKATI
LWDNAFSEMDRVPFMVAERVPWEKMCETLNLKFMAEVGTSQGLLPEHFLFLAQKIFNDNS
LNMETFQNRTVSWAQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQY
VNNLLHSEPDGTFLLRFSDSEIGGITIAHIIRGQDGTPQIENIQPFSVKDLSIRSLGDRI
RDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTLESQLPSM
VPTYDLQPSPEPFTMQFGSERMPRAPGLPVHPVPTYHMQPLEEMSTFQDGPSLQMASMAN
RMNQSQLNLPFDQTHPQVLIQSTDPAILNPNSLACSEVIMSEENRLEPPMFPLENWSEGL
PSLLPPTDQDLTKLLLEGQMETGAGSLPIQPLMSTSHYGQPSLTPSSHLDLRTNPSWGP
Download sequence
Identical sequences H9H8T9
XP_007506307.1.35504 ENSMODP00000027219 ENSMODP00000027219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]