SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027317 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027317
Domain Number 1 Region: 240-301
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000216
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027317   Gene: ENSMODG00000022796   Transcript: ENSMODT00000028859
Sequence length 325
Comment pep:novel chromosome:BROADO5:Un:24236162:24237136:-1 gene:ENSMODG00000022796 transcript:ENSMODT00000028859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASQTSILRVTTQSPCHEREGEGDPSGREGSRTKEMTCRYFLNGFCREGDNCQYSHGLSKD
PETVVCSNFQCTQEDCRRNEDQEPQVDPKFPPPPPSQSFPPLTDPLVDCNIGAAKPLKGN
FEAIGASTDDWVYAIEFVPGQPYYGRFVHPCTEGSPKGRRVEENFRGSLTEEEPGEPAVQ
ESPQKESPVYPNEDSRHLCRPRVRNTGDTVRSLRRIRPCLEAHEKDKKLAFAVQRSRHLV
CGICKEVIYQKANPKEIRFGILSNCSHTFCLKCIRQWRGDEQLENKILKACPECRVTSSF
IVPSEFWVEEQEEKQKLIEKYKEAM
Download sequence
Identical sequences H9H937
13616.ENSMODP00000027317 ENSMODP00000027317 ENSMODP00000027317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]