SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027318 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027318
Domain Number 1 Region: 84-138
Classification Level Classification E-value
Superfamily RING/U-box 2.47e-17
Family RING finger domain, C3HC4 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027318   Gene: ENSMODG00000022798   Transcript: ENSMODT00000028860
Sequence length 256
Comment pep:novel chromosome:BROADO5:Un:23882937:23883707:1 gene:ENSMODG00000022798 transcript:ENSMODT00000028860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQPSKVHGLRTEDSLIEGVSDQVLVAVLLGFAFLAAVGYALLRNAQQHIHPNNRELVR
VLREQLHREQDPPAPRPQFYTDLSCPICLHHASLPIETNCGHLFCGNCLIAYWRYGSWLG
MVSCPICRQTVTLLFPVFGEDVLSVDSRRLHQDIHDYNRRFSGQPRSLTDRLMDLPTLLR
HAFRELFSVGGLFWMFRIRIVLCLVGAFFYLISPLDLVPEGLFGILGFLDDFFVIFLLLI
YISIMYREVITQRLNR
Download sequence
Identical sequences H9H938
ENSMODP00000027318 13616.ENSMODP00000027318 ENSMODP00000027318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]