SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027553 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027553
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.25e-55
Family DnaQ-like 3'-5' exonuclease 0.0000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027553   Gene: ENSMODG00000022848   Transcript: ENSMODT00000029093
Sequence length 241
Comment pep:novel chromosome:BROADO5:X:10886315:10887040:-1 gene:ENSMODG00000022848 transcript:ENSMODT00000029093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELPTCETFVFLDLEATGLPNAHPEIAEISLFAIHRFSLEHPERDESGTLQLPRVLDKL
TLCMCPEQNFTPKASEITGLSNQNLADNHKAGFDGAVIRALWEFLKRQKSPICLVAHNGF
DYDFPLLRTELQRLGADLPGGTVCLDTLPALRGLDKAHHHSTRASHGKKSYSLGNLYRRY
FDDEPQAAHSAEGDVYALVMVFLHRAQELLQCVQTEAQNWDEIQPMYTPRKRRLSGGGLD
A
Download sequence
Identical sequences F6PJD0
13616.ENSMODP00000027553 XP_007507026.1.35504 XP_007507027.1.35504 XP_007507028.1.35504 ENSMODP00000027553 ENSMODP00000027553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]