SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027586 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027586
Domain Number 1 Region: 188-371
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.87e-50
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 8-176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-46
Family Canonical RBD 0.0000347
Further Details:      
 
Domain Number 3 Region: 498-623
Classification Level Classification E-value
Superfamily PABC (PABP) domain 7.33e-44
Family PABC (PABP) domain 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027586   Gene: ENSMODG00000013156   Transcript: ENSMODT00000016766
Sequence length 635
Comment pep:novel chromosome:BROADO5:X:29465795:29467702:1 gene:ENSMODG00000013156 transcript:ENSMODT00000016766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGATAIPMASLYVGDLHHDVTEAMLYEKFSPAGPILSIRVCRDMLTRRSLGYAYVNFQQL
ADAERVLETMNLDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLEKSIDNKALYKTFSAF
GNILSCKVISDENGSKGYGFVHFENQQAADKAIEKMNGVRLNNLKVYVGRFKSRKERELE
LGARAREFTNVYIKNFGEDMDNDRLTEVFGKFGHALSVKVMTDESGKSKGFGFVSYEKHE
DAQRAVDEMNGKEFNGKRIYVGRAQKKGERQTELKRHFEQVKQERSSRYQGVNLYVKNLD
DSIDDERLRKAFSPFGTITSAKVMMEGGHSRGFGFVCFSAPEEAAKAVSEMNGKLVATKP
LYVALAQRKRDRQVHLTNQYMQRMASFQAMSNPVFSPYQPPPTSRYFMTPLPQPQSRPAY
YPYGQIPQFRPSPPHWAVPGGRFHPFQTVPGVMRPRGPAPAPAPAPFNPVTSSSVPVSAL
MNTQHIVNPSSQMLGPPNPPFMPPMRSVQQYKYAAGVRNPKHLNMPLPVTTPQPAGLFEF
QEPLTASMLAATPPQEQKQILGERLFPLIQALNPALAGKITGMLLEIDNSELLHMLESPE
SLQAKVDEAVAVLEAHQAKEAAEKKGDTDPKMPPD
Download sequence
Identical sequences F6PHL0
ENSMODP00000027586 13616.ENSMODP00000027586 ENSMODP00000027586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]