SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027603 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027603
Domain Number 1 Region: 1661-1714,1958-2155
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-50
Family Tandem AAA-ATPase domain 0.0000711
Further Details:      
 
Domain Number 2 Region: 1460-1765
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-49
Family Tandem AAA-ATPase domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 212-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000775
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027603   Gene: ENSMODG00000003920   Transcript: ENSMODT00000029142
Sequence length 2362
Comment pep:known_by_projection chromosome:BROADO5:X:55917456:56102040:-1 gene:ENSMODG00000003920 transcript:ENSMODT00000029142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALKPNESKLNTLVQKLHDFLAQSSEESEEAHSPPRLTMSKVIDKGSRSGNTSDPMEVI
REEGSTSSEKAKSLGPHRSKRKPTVVTKYVGSDEEKVFDDTLNPDVSIDTSETDIAMQSL
PKGTVVVQPEPVLNEDKDDFKGPEFRSRSKMKTESLKKRGEEGLHGIVSCTACGQQVNHF
QKDSIYRHPTLKVLICKNCYKYYMSDDISRDADGMDEQCRWCAEGGNLICCDFCHNAFCK
KCILRNLGRKELSAIMDENNQWYCYICRPEPLLDLVTACDSVFENLEQLLQQNKKKIKVE
SEKSNKLFEHSHKFSPKKNVSTCNGEEKKVDDSHSGSVTYSFTALMVPKEIVKKTKKLVE
TTTSMNASFARFLKQASENSEMSTVVKLRQLKAFKSVLNDIKKVHHSLEEGVNMEIRALD
TLNKETVTMEHKADILKPETEVTKLEVYYESKKKDFSKCDNKLSMKRVGSEMVGQSLPVV
GQPANKSAGAEDKKSNRKEARFEPANTSEALDMDIVSVPSSVPEDIFENPEAAMEVQVSS
ENQRDGNNATERDVEHSVKSKDHKGVKAADCQEATQEKEENKSSVTSKAENRSSQKERSC
DEDFVENDIPLVSEEADLRRSPRVKTTPLRRQTEANPITSNSDEENNDVYNEKRKRKSLV
QSVKKDKRTSSDSAIDSPKPTKVPKCKPLDTVAPSSDSEEIPAVLKEVAMMSHSSSDTEQ
NETNENVPKKSLYDIKTQTSKGDKGKRKRKNSTSGSEFDTKKGKAVKSFTGSKKKRHSHS
ESSNYDSELEREIKNMCKIGAAKQSQKRHSNKEDYGSSEDEKQNAKGSSKQKKKGTKTLI
NESSDDDGEDRQKNSCFSEDTVNKESMSSQLREPVTKKDAATSSDVHKSYVKEEVCSSPE
TCKEAEAIEQSRHLKSKPMKKDSSFDDVTEKSSQKEECGDSSEDEKKQKKRRIETKEKKS
SELKKFPSQENEVTSSDIIEKSLEREDSSHLTEDFDQNKQGSAEAEKKNKKLREKNSKKK
EELSDDIEKLTGKSESGDYSEGKKGLSGRERKKENLGEKSSKTVHYGSSSDVEKCLPKEE
CCDSSDEKRRKRIESRERRNLSAKINIKAKQSGSSSSEAEESFSEDSKRKKKIPLTKNKK
KENVKDKKKKSPRRNGKKQQEIISSSSDELGDDDQNSTGEGSGDEQKIKPVTEDITLPSN
VHSSGDEADRRDPVNVDDDEDEDDPENRIAKKMLLEEIQANITTDEDASSDEEPTKMKKR
SAKQNEENTGDESEPQKEHNVEHDEHGNSDTDSDSEQSKKPRYRHRLLRHKLSGSDGESG
EEKKSRPKETKETKRRNRRKVSSEDSVDTDFQESGVSEEVTESEDDQRPRTRSAKKAELE
ENQRSYKQKKKRRRIKVQEDSSSENKSNSEEEDENDDSKSPGKGRKKIRKILKDDKLRTE
TQNALKEEEERRKRIAEREREREKLREVIEIEDASPIKCPITTKLVLDEDEETKEPLVQV
HRNMVTKLKPHQVDGVQFMWDCCCESVSKTKKSAGSGCILAHCMGLGKTLQVVSFLHTVL
LCDKLDFSTALVVCPLNTALNWMNEFEKWQDGLDDEEKLEVSELATVKRPQERSYMLQRW
QEDGGVMIIGYEMYRNLAQGRNVKSRKLKEIFNKALVDPGPDFVVCDEGHILKNEASAVS
KAMNSIRSRRRIILTGTPLQNNLIEYHCMVNFIKENLLGSIKEFRNRFINPIQNGQCADS
TMVDVRVMKKRAHILYEMLAGCVQRKDYTALTKFLPPKHEYVLAVRMTPIQCKLYQYYLD
HLTGVGNSSEGGRGKAGAKLFQDFQMLSRIWTHPWCLQLDYISKENKGYFDEDSMDEFIA
SDSDETSMSLSSDDYTKKKKSKGKKGKKDSSSSDSCSDNDVEVIKVWNSRSRGGGDGSVE
EIPNISAVSFKQEESKTASSSNPSSPAPDWYKDFVTDADAEVLEHSGKMVLLFEILRMAE
ELGDKVLVFSQSLISLDLIEDFLELASREKSDDKDKPLIYKGEGKWFRNIDYYRLDGSTT
AQSRKKWAEEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRV
YRFGQNKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFTMNELTELYTFE
PDLLDDPNSEKKKKRDTPMLPKDTILAELLQIHKEHIVGYHEHDSLLDHKEEEELTEEER
KAAWAEYEAEKKGLTMRFNMPTGTTLPPVNFNSQTPYIPFNLGALSTMSNQQLEDLINQG
REKVVEATNSVTAVRIQPLEDIISAVWKENMNLTEAQVQALALNRQASQELDVKRREAIY
NDVLTKQQMVRVPQSLNCILFH
Download sequence
Identical sequences F6Q374
ENSMODP00000027603 ENSMODP00000027603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]