SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027604 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027604
Domain Number 1 Region: 143-233,275-356
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.7e-44
Family Canonical RBD 0.0000945
Further Details:      
 
Domain Number 2 Region: 47-138
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.82e-25
Family Canonical RBD 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027604   Gene: ENSMODG00000003850   Transcript: ENSMODT00000029143
Sequence length 361
Comment pep:novel chromosome:BROADO5:X:55424314:55425498:-1 gene:ENSMODG00000003850 transcript:ENSMODT00000029143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARVRVPTLASALGEEAAAASPHLPPASAPIETPGVAGASTSSATTEPASSGSSDPKTNLI
VNYLPQSMTQEEFYNLFATVGKIQSCKLVRDRSTGQSLGYGFVNYVDPRDAEQAVCLLNR
LQCPPKTIKVSFARPSSSSIRDANLYVSGLPRNMMQKDLEQLFSPFGRIITSRILIDRVS
GASRGVGFILFDKKSEAEEAIKALNGQKPCGNRVPLIVKFAQHQTQRTPQGYLSQTSRFG
QEGFFNMPYGVQNMAPPSYSGAPNMAGITYPGHTSSGWCIFVYNLSPDSDENVLWQLFGP
FGAVSKVKIIRDFNTNKCKRFGFVTMTSYNEAALAVASLNGYCLGGRVLQVSFKTNKIHK
A
Download sequence
Identical sequences F6Q365
ENSMODP00000027604 13616.ENSMODP00000027604 ENSMODP00000027604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]