SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027677 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027677
Domain Number 1 Region: 392-572
Classification Level Classification E-value
Superfamily NTF2-like 3.73e-55
Family NTF2-like 0.00000032
Further Details:      
 
Domain Number 2 Region: 120-211
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.13e-29
Family Non-canonical RBD domain 0.00011
Further Details:      
 
Domain Number 3 Region: 215-370
Classification Level Classification E-value
Superfamily L domain-like 1.46e-28
Family mRNA export factor tap 0.00000202
Further Details:      
 
Domain Number 4 Region: 575-641
Classification Level Classification E-value
Superfamily UBA-like 8.67e-23
Family TAP-C domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027677   Gene: ENSMODG00000014379   Transcript: ENSMODT00000018301
Sequence length 642
Comment pep:novel chromosome:BROADO5:X:55034837:55036819:1 gene:ENSMODG00000014379 transcript:ENSMODT00000018301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQGKPEGNSCSENSSAQRLKKSRGGSLRRKYHSESKSSSSSSSGSRGYSQGPPRSARE
DRDDPFEGQEASRARYSPHRSRIERGKWWERGGSRIHATVKRREREKERERHSLDRGVAL
SNQIPLSKQWFKVTISNGRNYDKTWLLSTLRGKCNVALNPVDFHYDDKKALFFVEDPHIA
SALKAADHNIVDGDNRRISIVVNTSSPPYSVQNELKPEQLEQLKIVMSKRYDNAKKTLSL
KGLRSEPDLMIQCIDIVLNRKNYMTALVQIIGENIPELLSLNLSNNRIYKLDDFADIVHK
APNLRSLNLSCNELKSERELDKVKELKLDELWLVGNPLCKSFRNRASYLTAIRERFPKLL
RLDGHDLAPSVALNAQTRPPVALNVEMPALLPACKGSFFGSETLKGMVTYFLQQYFSVYD
SGDRQGLLDAYHEEACCSLSISANIQNPSQYNMSEYVKDNRNVKKVKDPGLRFHLLKHSR
LAVITFINELPKTQHDMSSFVVDVCAQTETLLCFSVHGLFKEVEEKSNAIRAFTRMFIAV
PSNNATRMCMVNDELFVRNANPEEIHRAFAAVPAPPTSSFISMVNIFQEQQSIIQLFSTQ
SGMNLEWSKKCLQDNNWDFPRAAQIFTQLKVEGKIPAVAFQK
Download sequence
Identical sequences F6PYN9
13616.ENSMODP00000027677 ENSMODP00000027677 ENSMODP00000027677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]