SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027694 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027694
Domain Number 1 Region: 230-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000602
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027694
Domain Number - Region: 696-734
Classification Level Classification E-value
Superfamily RING/U-box 0.000177
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number - Region: 574-646
Classification Level Classification E-value
Superfamily Tropomyosin 0.00271
Family Tropomyosin 0.0089
Further Details:      
 
Domain Number - Region: 206-228
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0837
Family CCCH zinc finger 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027694   Gene: ENSMODG00000016188   Transcript: ENSMODT00000029232
Sequence length 738
Comment pep:known_by_projection chromosome:BROADO5:6:155524426:155669054:-1 gene:ENSMODG00000016188 transcript:ENSMODT00000029232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYLCIAYRYVNACIYTYTHKHMYVIILSAYRFSCLWKLLLALGCPYLHRTTGDTERKYH
LRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVYDIRELQAQEALQNGQLGSGD
SIPDLQPGVLASQAMIEKILGEDPRWQDTNFVLGGYKTEQCPKPPRLCRQGYACPHYHNS
RDRRRNPRKFKYRSTPCPSVKHGDEWGEPSKCESGDNCQYCHSRTEQQFHPEIYKSTKCN
DMRQTGYCPRGPFCAFAHVEKDTMNVVMMQNSGQSKPGAHMFSTESIGITNDWNCHDPNS
TNNITNNNGQPGNISCSNSPTVTSSSGSSSSLSPIGPLCRQRSLANGGLCSESTTSGVSS
PTSSYPKAPGFEREDQAKQRNLPTENNQKISEQDNKQNHLSVFAVVNPLASSITSSITSS
LASSIGSGSSSPTTLSAINAKALPFYPPSNTVESVIGQRLLGSSAPVNIPGSLPRSPSLH
SSSSLSTSPLSSLSQSLSQPLIPSTMTPHQQQPQHLKSEHNVLGTSASSHNSLGLNGVNG
SIWDFVTGSFSPSPSPILSTGTAPSSNSSAHGSELARVRRELDEAKRKIKQWEDSWQQVK
QACDAWQREAHEAKERAKVADTDKQLALQKKEEVENKFKRLQEEFERLGLSSKFPVLRSY
GDIETIPLPKLHSLQSQLRLDLETVDGVIFQLHSKKCVVCHEHDRSIVLQPCQHYVLCEH
CASNQPECPYCKAQPIKW
Download sequence
Identical sequences F6PY56
ENSMODP00000027694 ENSMODP00000027694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]