SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027999 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027999
Domain Number 1 Region: 997-1167,1206-1313
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.2e-39
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027999
Domain Number - Region: 694-726
Classification Level Classification E-value
Superfamily RING/U-box 0.00053
Family RING finger domain, C3HC4 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027999   Gene: ENSMODG00000009450   Transcript: ENSMODT00000029578
Sequence length 1368
Comment pep:known_by_projection chromosome:BROADO5:1:716933849:717018844:-1 gene:ENSMODG00000009450 transcript:ENSMODT00000029578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKAGCEGGASLHAPCPAAAMVLTLGESWPVLVGKRFLSVSASKECVGSGHSFEVERVDE
WPWVSGTIRAVSHIDVTKKDLKVCVEFDGESWKKRRWIEVYSLQRKAFLVEHNLVLAERK
SAEIVQWPAILYKSLLDKTGLGSITSIRFLGEDRRVFISKDLLKPIQDVNGLRLSLMDHQ
NISKEFQALIVKHLDESHLLQGDKNLVGSEVKIYSLDPSTQWFSATVVNGNPTSKTLEVR
CEEIPALKIVDPALIHVEVVHDNLGNCGKTKRVGATKRKSSENKGGLAAKQSRPCSEASS
SSSPSPVQSVPTTVLSEVLPGCTATTPPSQNLRQSTPPAASSPPDLGANSPQADDTQSLP
EEFSSCLNTKTETVGKNTDAESLCKQAAEAVTEDSNNPSEPNMNYTQLKTLNCLPSTNTP
NYDESDKKNPLESLDPSPADAPLEDLTPVAQEPQESSQEESEATETSELQKHLDCKPSTS
NLCAAPASEPSGKAPLTSRPNNAEGRNPEKAPFICPSLWGLSKETVGVRHENDWHAGSGS
KVQNVPARKSVLMDPAKVKKLQQSGEAFVQDGACAAITANLSKCRECRLDSYRKDKDSPV
FCRFFHFRRLQFNKHGVLRVEGFLTPNKYDMEAIGLWLPLAKNVVGTDLDTAKYILANIG
DHFCQMVISEKEAMSTIEPHRQVAWKRAVRGVREMCDVCDTTIFNLHWVCPRCGFGVCVD
CFRMKRKNVPQGGTYKTFAWIKCVKSQIHEPDNLMPTQIIPGKALYDVGDIVHSVRAKWG
IKANCPCASRQLKLLSKPAPKEDARQNTLAGEKLSGLGAALQRNSCVLDSANGSCDPAIK
PSCGTKPVCSVSSSPLNWLADLTSGNVNKENKEKPLTMPTLKNENKSLQSLPTLTKPPTV
LHTFNSTILTPVSNNSSGFLRNLLNSSGGKTENGLKNTPKILDDIFASLVQNKTSCDTPK
KPQGLIIKPSILGFDTPHYWLCDNRLLCLQDPNHKSNWNVFRECWKQGQPVMVSGVHHRL
NAELWKPDSFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDIPSRLKNDDEPMVLKL
KDWPPGEDFRDMMPSRFEDLMTNIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYG
LITPEDRKYGTTNLHLDISDAANVMVYVGIPKGQLDQEDEVLKTIQDGDCDELTIKRFIE
GKEKPGALWHIFAAKDTEKIRSFLKKVSEEQGQENPVDHDPIHDQSWYLDRPLRKRLHQE
YGVQGWAIVQFLGDVVFIPAGAPHQARTGGARVHNLYSCIKVAENFVSPEHPPPTGSLPC
VSLISASPCLTQSSDGSPCGLWVKNVIYHAVKDAVAILKANECGFGKP
Download sequence
Identical sequences F6RDX7
13616.ENSMODP00000027999 ENSMODP00000027999 ENSMODP00000027999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]