SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028411 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028411
Domain Number 1 Region: 373-478
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 485-526
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000994
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028411   Gene: ENSMODG00000023104   Transcript: ENSMODT00000029993
Sequence length 539
Comment pep:known_by_projection chromosome:BROADO5:1:651022908:651024527:-1 gene:ENSMODG00000023104 transcript:ENSMODT00000029993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVGKMWNNFKYRCQNLFNHEGGNNNENTVVNSNRCLSVKERNISIGDLAPQQQSSPLR
ENVALQLEISPSKNSSRRNQNCATDIPQIVEISIEKESDSCITTTGTRLARRDSYSRHAP
WGGKKKHSCSTKTQSSLDTEKRFGRTRSGLQRRERRYGVSSVHDMESVSSRTVGSRSLRQ
RLQDTVGLCFPMRTYNKQAKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAP
VSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKL
GPKLAPGMTDMTGDGAVAPQGSCDSEEDATTLCLQARRQKQRQGSGDSHGHAHTGRQGAW
KVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSV
SFRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTVSLN
RTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPIKAK
Download sequence
Identical sequences F7AZP2
ENSMODP00000028411 XP_007476925.1.35504 XP_007476926.1.35504 XP_016278353.1.35504 13616.ENSMODP00000028411 ENSMODP00000028411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]