SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028657 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028657
Domain Number 1 Region: 384-710
Classification Level Classification E-value
Superfamily DNase I-like 1.57e-55
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000825
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-27
Family SH2 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028657   Gene: ENSMODG00000010448   Transcript: ENSMODT00000030240
Sequence length 1095
Comment pep:known_by_projection chromosome:BROADO5:2:520461740:520587711:-1 gene:ENSMODG00000010448 transcript:ENSMODT00000030240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCWNHGNITRSKAEELLSKTGKDGSFLVRASESIPRAYALCVLYRTCVYTYRILPNEE
DKFTVQASEGVPVRFFTSLDQLIEFYKKENMGLVTHLQYPVPIEEEEAGDELEEETEFFL
SPPELPPRNLPLSSGASEAKEVLPPDNSRVMEPSKLSLSETLLQRFQGMDTSGLPEEHLK
AIQDYLSTQVSLDTDFVKTGANNLPHFKKLIMVLCKELYSEVTRTLPTLEALQRLFDQQL
SPGIRSRPQACAEASPVNIMAKLGQLTSLLSSLEDKGKAFLGGGPESTHRRSLIPPVTFE
VKSESLGIPQKMQLKVDVESGKLIIKKSKDGPEDKFYSHKKILQLIKSQKFHNKLVIVVE
TEKEKTLRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGDAPPPKKI
TSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLEILKHSLQEITDITFKMVAI
HTLWNIRIVVLAKLEHENRISHICTNNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHL
TSGSEKKLRRNQNYMSILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRLELPPSEAENI
IQKIKQQQYPELLLHDQLLTERKEQKVFLHFEEEEITFAPTYRFERLTREKYAYTKQKAT
GMKYNLPSWCDRVLWKSYPLVHVVCQSYGCTSDIMTSDHSPVFATFEVGVTSQFVSKNGP
GNVDSQGQIEFLNCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGTEGELVVKFAD
DLPKLTPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRSEAIESLVPIYTALTHHGE
MMGHFRGEIKLQTSQGKKRERLYDFVKIERDEASGQKSLKSLISHDPIKQWECSSRLTDL
GKNMAEPSPMDEQLLAKPEMFENPLYGAVSVFPKPAPRKEQESPQTLRKDRPGCPDPGTP
SPAVIFTKPPEGEGKLASRQTSAPLLPVPRMRSFTCSSSTEGRTTLSGEKTQGKPKPSTP
SENPVPAKRPVKPVRSEMSQQGNPAQTSRPPLPAKSPAVLHLQHSKARDYRESSELPHHG
KHWPEEGPTSRTSMQ
Download sequence
Identical sequences F7GAI6
ENSMODP00000028657 ENSMODP00000028657 XP_007485891.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]