SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028717 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028717
Domain Number 1 Region: 10-129,169-195
Classification Level Classification E-value
Superfamily SH2 domain 6.42e-26
Family SH2 domain 0.0000027
Further Details:      
 
Domain Number 2 Region: 143-235
Classification Level Classification E-value
Superfamily SH3-domain 2.71e-24
Family SH3-domain 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028717   Gene: ENSMODG00000010187   Transcript: ENSMODT00000030299
Sequence length 305
Comment pep:known_by_projection chromosome:BROADO5:2:516867870:516878197:-1 gene:ENSMODG00000010187 transcript:ENSMODT00000030299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPASAAAAPPLPLPPAAAQPGPGLNPSRLRIGDQEFDSLPALLEFYKIHYLDT
TTLIEPVPRSRQHSGVILRPEEEYVRALFDFNGNDEEDLPFKKGDILKIRDKPEEQWWNA
EDSEGKRGMIPVPYVEKYRPASASVSALIGGNQDNSHPQPLGGPEPGPYAQPSVNTPLPN
LQNGPIYARVIQKRVPNAYDKTALALEVHNGQNVERRDLLQGSPFQTYYSFVDVQCESTS
IVMLL
Download sequence
Identical sequences F7D8F3
ENSMODP00000028717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]