SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028798 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028798
Domain Number 1 Region: 101-190
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.03e-29
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.6e-26
Family Canonical RBD 0.0000215
Further Details:      
 
Domain Number 3 Region: 206-314
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-23
Family Canonical RBD 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028798   Gene: ENSMODG00000011515   Transcript: ENSMODT00000030378
Sequence length 385
Comment pep:known_by_projection chromosome:BROADO5:1:563757477:563790969:1 gene:ENSMODG00000011515 transcript:ENSMODT00000030378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFYEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTLRSQDHFHVFVGDLSPEITTE
DIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN
WATRKPPAPKSTYESNTKQLSYDDVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQI
MEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMLNPVQQQNQI
GYPQAYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNLAPTSAPWMGANYGV
QPPQGQNGSMLPNQTGYRVAGYETQ
Download sequence
Identical sequences F7C4H9
ENSMODP00000028798 ENSMODP00000028798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]