SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028840 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028840
Domain Number 1 Region: 16-79
Classification Level Classification E-value
Superfamily BRCT domain 0.0000948
Family DNA ligase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028840   Gene: ENSMODG00000023191   Transcript: ENSMODT00000030418
Sequence length 79
Comment pep:novel chromosome:BROADO5:1:557071639:557071875:1 gene:ENSMODG00000023191 transcript:ENSMODT00000030418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICRLERHLSTGQYQGDLFASQPVMFITAASEPPCAKLRELVQLCGGHVSRSPFVASIYIG
PYRGKKLPQIKHLSEKWIL
Download sequence
Identical sequences F7F8Y8
ENSMODP00000028840 ENSMODP00000028840 13616.ENSMODP00000028840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]