SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029097 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029097
Domain Number 1 Region: 48-266
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-61
Family DBL homology domain (DH-domain) 0.0000156
Further Details:      
 
Domain Number 2 Region: 252-398
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-34
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 3 Region: 513-643
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-31
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 415-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.39e-28
Family DEP domain 0.0031
Further Details:      
 
Domain Number 5 Region: 623-711
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000125
Family PDZ domain 0.035
Further Details:      
 
Domain Number 6 Region: 714-776
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000759
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029097   Gene: ENSMODG00000016258   Transcript: ENSMODT00000030675
Sequence length 1655
Comment pep:novel chromosome:BROADO5:1:497495601:497706364:1 gene:ENSMODG00000016258 transcript:ENSMODT00000030675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPAGGSSAGPPESLILGPAATPGPGPGPITASAGPAAAAAAAARDSERQLRLRLCVLN
EILGTERDYVGTLRFLQSAFLHRIRQNVADSADKCITEENVKILFSNIEDILEVHKEFLN
ALEFCLQPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLMELNKIPAIRAFLLSC
MLLGGRKTTDIPLEGYLLTPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCT
NINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFD
NLLVYCKRKSRVTGGKKSAKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTV
TNGWKIHNTAKNKWFVCMAKTAEDKQKWLDAIIKEREQRESLKLGMERDAYVMIAEKGEK
LYHMMMSKKVNLIKDRRRKLSTVPKCFLGNEFVAWLIEIGEISKTEEGVNLGQALLENGI
IHHVSDKHQFKNEQVMYRFRYDDGTYKPRSELEDIMSKGVRLYCRLHSLFIPVIKDRDYH
LKTYKSVIPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRF
HADEEMEGTSSKNKLLRNDFKLVENILARSLLILPQEDDYGFDIEEKNKVIVVKSVQRGS
LAEMAGLQVGRKIYSINEDLVFLRPFSEVDAILNQSFCSRRPLRLLVASKAKEIIKVPDH
PETLCFQIRGTSPPYVHAVGRGSEAAAVGLNAGQCILKVNGNNVVNESFVDVLDHFLAYR
SRPQEALGLYQWIYRTHEDAEEARAQQWAPGSYLNGSLDESGGALEGGQDDEDFSLQPMG
PQLPIPEGSPLINLTVENVHLEHGVVYEYVSTAGIKCFVLEKIVEPKGCFALTAKILEAF
AADDSLFVQNCGRLISLSSTVATMPQYEFRNICETKLERITRRIANYQEFAEKLKTRVSP
AFKQASLEPHALCSLDFCPTNCHVNLMEVSYPKNTTSVGRSFSIRFGRKPSLIGLDPEQG
HINPMSYTQHCITTMAAPSWKCLPQEDGEPHERNLMDSTINPQNGGPIQEDRGLSFLLKQ
EDREIQDAYLQLFNKLDVAVKEMKQYVMQINKLLSTITEPTGDGSCEPPSTEEVSPSPLV
SEDSEIDKADHGGIKKVCFKVSEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNS
SYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGSVMSKAFEETKH
FPMEHSLQDFKQKEECPIRGRSMIQISIQEDPWNLPNSIKSLVDNIQKYVEDGKNQVLLA
LLKCTDTELQLRRDVIFCQSLVAAICTFSDQLLAALSYRYNNNGEYEESSRDASRKWLEQ
IAATGVLFHYQSLLSPSVKEERAMLEDIRVTLSELDNVTFSFKQLDENFVTNAHVFYHIE
GSRQALKVIFYLDSYHFSKLPTRLENGGSLKLHTVLFTKALENLEGQLQAGGSTTSLLEE
MQQEINAQSLEKVQHYYRRLRTFYLERSNLPTDASATAVKIDQLIRPINAMDELCRLMKS
FVHSKPGTSVPSAGLLPISSELCYRLGACQITMCGTGMQRSTLSVSLEQAAILARSHGLL
PKCIMQATDIMRKQVSLRPQGPGMGHGSHPGIPQI
Download sequence
Identical sequences F6TG39
XP_007475836.1.35504 ENSMODP00000029097 ENSMODP00000029097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]