SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029243 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029243
Domain Number 1 Region: 28-150
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.42e-34
Family Canonical RBD 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029243   Gene: ENSMODG00000023276   Transcript: ENSMODT00000030816
Sequence length 156
Comment pep:novel chromosome:BROADO5:2:441398578:441399048:-1 gene:ENSMODG00000023276 transcript:ENSMODT00000030816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLLSALQSDSYVELGWYRDQHFRGKMDDQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKVKKTACGFCFVEYYCRADAENAMRYINGTRLDDRIIRTDWDAGFR
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKIVQNQ
Download sequence
Identical sequences F6SWT4 G3WG21
ENSMEUP00000007414 XP_012404904.1.9362 XP_016284481.1.35504 XP_020842376.1.61212 ENSMODP00000029243 13616.ENSMODP00000029243 ENSMODP00000029243 ENSSHAP00000014376 ENSMEUP00000007414 ENSSHAP00000014376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]