SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029254 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029254
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily ENTH/VHS domain 8.11e-30
Family RPR domain (SMART 00582 ) 0.0067
Further Details:      
 
Domain Number 2 Region: 416-545
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-17
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029254   Gene: ENSMODG00000008301   Transcript: ENSMODT00000030827
Sequence length 1266
Comment pep:known_by_projection chromosome:BROADO5:2:435703878:435892037:1 gene:ENSMODG00000008301 transcript:ENSMODT00000030827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTRSILYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLY
VIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFK
SEIIQPLLDMAAGIPPPVVTPILPSTAASMSNNTPGTPVTPVTPANVVQGLPDPWVSQIA
NTDTLAAVAQILQSPQGQQLQQLIQTLQIQQQKPQPSLLQALDAGLVVQLQALTAQLTAA
AAAANTLNPLDQAVSFNKLMDRFDFGEDSERSEEAKKETPSSQLSHVSESVNNSIFHQLA
EQLQQQNLEHLRQQLLEQQQPQKVTTQENPESTFGSEHSASPSQGSSQQQFLEPETNLDD
SIDIQQQDMELDEGQDVAEEEVFEQEEKKVPIRSRSRTHSRSRSRSPRKRRSRSRSGSRK
RKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQKKGLPPIRSKTLSVCSTTLWVGQV
DKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMVHRQDSYRALQKLSSGSYKIGSKVI
KIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDDLDGFAEGGMIDQETVNSEWETVKS
SEPVKEPVQTVESPTTVEKTPVVTTQAEVYPPPVAMLQIPVAPAVPTVSLVPPTFPVSMS
VPPPGFSAIPPPPFLRASFNPSQPPPGFMPPPVPPPVVPPPTIPPVVATSLVQPPISMTP
ETMKDVAFSNLVLPVGSVSSSLATSTISAGSVFNPPSNQPESEEKLSHLTDHQLSSSEST
RQVIHNDVTSSSGMLGGQPPNMSSSSGILGGQPPNVSSNSGILGVQPSNVSSSSGIIGAQ
PPNIPSSSGILGPQLPNVSGSSGLLGVPPPNIPGNSGLLGVQPPNVPSNSGMLGPQPPTG
PQNLPPLNIPQRMPGIPILDIRPGLIPQSPGPRFPLMQPGLPPQRGIPPPAILDASLHPP
PRGPFAPGDIFSQAERPFPAPLRQNIDHLPNPEKRLPLGNDSIQQEGDRDYRFPPMENRE
TISRPSPVDVRDVVGRPVDPREGPGRPPIDGREHFGRPHIDIRENLIRPGLDNLGRRDHF
GFNSDKPWGHRDFDEREHRVLPLYGGPKGFHEDRGRFRHGNYRFDPRSGPIWNRGFGQDA
HRDFDDRRRPWERQRDRDDRDFDFCREINGNRFGRDRIQNTWVPHPHPRVFDYFEGPSPQ
RKADNVPQVNGENTETDNQPPPLQVQNDPELYEKLTSSSELNKEKNDTEADIESEPVVES
TETEGT
Download sequence
Identical sequences F6SEJ6
ENSMODP00000029254 ENSMODP00000029254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]