SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029701 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029701
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.07e-19
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029701   Gene: ENSMODG00000023381   Transcript: ENSMODT00000031273
Sequence length 325
Comment pep:known_by_projection chromosome:BROADO5:4:413083488:413087863:1 gene:ENSMODG00000023381 transcript:ENSMODT00000031273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHXXXKHADGKEMM
PSGVLVDVERGRTRGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERGPGPCPPRD
RDRERERERRERSRERDKERDRRRSRSRDRRRRSRSREKEERRRSRERSKDKERERKRRS
SRSRERARRERERKEEPRGGEGPEPPEAGDAPPDDGPLGEPGPDGPDIPEEKGRDRDRDR
RRSHRGERERRRDRDRDREHKRGDRGERRDEAPRGGGGGGGGGGGGQDNGLEGLGADGRD
LYLEADAGDGYLAPENGYLMEPAPE
Download sequence
Identical sequences F6U6Z5
13616.ENSMODP00000029701 ENSMODP00000029701 ENSMODP00000029701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]