SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029789 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029789
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.02e-27
Family Canonical RBD 0.0000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029789   Gene: ENSMODG00000023422   Transcript: ENSMODT00000031359
Sequence length 125
Comment pep:known_by_projection chromosome:BROADO5:4:412663627:412664732:-1 gene:ENSMODG00000023422 transcript:ENSMODT00000031359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSESPKESEQLRKLFVGGLSFETIDKSLWSHFEQQGTLTDCVVMRDPNTQGSRGFGFV
TYATVEEVDAAMNTRPHKVDGRVVEPKRAVSREDSQRPGTHLTVKKTFCRGHQRRHRGAS
LKRLL
Download sequence
Identical sequences F6T8I2
ENSMODP00000029789 ENSMODP00000029789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]