SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030260 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030260
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily NTF2-like 1.11e-25
Family NTF2-like 0.0085
Further Details:      
 
Domain Number 2 Region: 319-421
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000175
Family Canonical RBD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030260   Gene: ENSMODG00000023523   Transcript: ENSMODT00000031831
Sequence length 448
Comment pep:novel chromosome:BROADO5:3:511042337:511043718:-1 gene:ENSMODG00000023523 transcript:ENSMODT00000031831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMEKPSPLRVGREFVRQYTLLSQAPDMLHRFYGKDSSYVHGGLDSNGKPADAVYGQKEI
HGRVMSPNFTNCPTNIRHVDAHATLNDGIVVQVMGLLSHNHQAFPRSMQTFVLAPEGSVA
NKFHVHDDIFRYQDEVFGGFITEPQEESEEDVEEPEERRQTPEVTVSNALEEHLEEPVVE
PEPEQEAETESQEEKPGPALEEPVSEETPKSSSSPVPVDTAPAVQEDLRTFSWASVTRKN
LPPSGAVPVSGIPPHVVEVPALQARQESKPESQTPPQRPQRDPRIREQRTNIPSQRGPRP
IHEGGEQGDMDTRRIVRYPDSYQLFVGNLPHDVDKAELKDFFRSHGNVVELQIHSGGKLP
SLGFVVFDDLKPVQKILGSRPIMFRGEARLNVEEKKTRALREGDRRDNRPRGPGGPRSGL
SGGIRGPPWGGMSQKPGFGGGRGIGQCQ
Download sequence
Identical sequences F6Z1R2
13616.ENSMODP00000030260 ENSMODP00000030260 ENSMODP00000030260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]