SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030328 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030328
Domain Number 1 Region: 227-391
Classification Level Classification E-value
Superfamily LigT-like 0.000000000000209
Family 2'-5' RNA ligase LigT 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030328
Domain Number - Region: 19-39
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000424
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030328   Gene: ENSMODG00000023541   Transcript: ENSMODT00000031900
Sequence length 393
Comment pep:known_by_projection chromosome:BROADO5:4:406171114:406172292:-1 gene:ENSMODG00000023541 transcript:ENSMODT00000031900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAAKSPDGGMEEAGPPAPTCRFYQEGRCHFGARCRLPHPGAQAEPGPEPPSGPPRGKKA
PMRTARAVIDRILWDPQLDPDDFSVGYVDRFRGVLEEPFNAFCWDQDLAALGPGVLAVPQ
HRIRYFRHRGRLVWDRASRTDLVFGSAAGRWTTILDGATEAGETEPCGPGEEGAAEAGPQ
GEDGAPEPGPQGEAPTPTSSGESQGGSLDGSSLLEAEGECCPGLRPTHFVALPINDPGLR
QAVAKAQARLVAAEPSLGSSLVDPDALLLTLVLLRLTGPGEVAAAAGALRRLVRAPGFHP
PEELHFGGLACLDSRVIYSVPSPDLRGLARALARELEAQGLQVLERPGQALGPHLTLAKV
PFGSPACLFLPGAQEGAELGSQAAEGLALCSVG
Download sequence
Identical sequences F7DDD9
ENSMODP00000030328 ENSMODP00000030328 13616.ENSMODP00000030328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]