SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030375 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030375
Domain Number 1 Region: 329-391
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.56e-22
Family LIM domain 0.0069
Further Details:      
 
Domain Number 2 Region: 388-450
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.53e-19
Family LIM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 447-509
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2e-18
Family LIM domain 0.0035
Further Details:      
 
Domain Number 4 Region: 301-327
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000571
Family LIM domain 0.0057
Further Details:      
 
Domain Number 5 Region: 506-535
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000107
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030375   Gene: ENSMODG00000015114   Transcript: ENSMODT00000031947
Sequence length 536
Comment pep:known_by_projection chromosome:BROADO5:3:509048097:509060862:-1 gene:ENSMODG00000015114 transcript:ENSMODT00000031947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVLDPPDQWQSGGPRYIHQQSQ
PQSPVFGSGAKNPGVPVSRDSLGSPCPRGAGEEEHVYSFPNKQKSAEPSPTMSSSLGSNL
SELDRLLLELNAVQHPTSGFLADDANQSPPVPGGLSPQYGIPENNSPLGGKATPSSERRS
PSGNGARGLEDLRPSVESLLDELESSVPSPVPAITVNQGEMNHPQRVTSSQQQTRISASS
ATRELDELMASLSDFKFMAQGKVGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAK
GVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSP
RCHYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPK
CGGCARAILENYISALNTLWHPECFVCRVCFTPFVNGSFFEHDGQPYCEVHYHERRGSLC
SGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFVKLFC
Download sequence
Identical sequences F7C9G9
ENSMODP00000030375 ENSMODP00000030375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]