SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030693 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000030693
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily SET domain 0.085
Family Histone lysine methyltransferases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030693   Gene: ENSMODG00000023609   Transcript: ENSMODT00000032263
Sequence length 87
Comment pep:known_by_projection chromosome:BROADO5:1:398229804:398230064:-1 gene:ENSMODG00000023609 transcript:ENSMODT00000032263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS
CWGNCFLYHCTGSHLPESAHDPRIVGT
Download sequence
Identical sequences F7EWW2 Q4G2S9
ENSMODP00000030693 13616.ENSMODP00000030693 ENSMEUP00000010111 ENSMEUP00000010111 XP_003339555.1.35504 XP_007474422.1.35504 XP_020846421.1.61212 XP_020846423.1.61212 ENSMODP00000030693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]