SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030757 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030757
Domain Number 1 Region: 793-1069
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.31e-71
Family Tandem AAA-ATPase domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 559-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-53
Family Tandem AAA-ATPase domain 0.0000726
Further Details:      
 
Domain Number 3 Region: 435-508
Classification Level Classification E-value
Superfamily Chromo domain-like 1.32e-16
Family Chromo domain 0.0053
Further Details:      
 
Domain Number 4 Region: 295-342,369-415
Classification Level Classification E-value
Superfamily Chromo domain-like 2.33e-16
Family Chromo domain 0.019
Further Details:      
 
Domain Number 5 Region: 193-249
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-16
Family PHD domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030757
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily HMG-box 0.087
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030757   Gene: ENSMODG00000007509   Transcript: ENSMODT00000032327
Sequence length 1787
Comment pep:known_by_projection chromosome:BROADO5:2:254524530:254549901:-1 gene:ENSMODG00000007509 transcript:ENSMODT00000032327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSSAV
SSVTSTAPPGPPPPPADLQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPL
KIKLGLLGGKRKKGGSSDEGPEPEAEESDLESGSIHSASGRPDGTTRTKKLKRGRPGRKK
KKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEG
KWSCPHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACIS
SYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILYWRWGEPPVAAPTPQLAEGSPDI
QVPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYG
SGEDDGKSDKRKSKDPHYAEMEEKFYRFGIKPEWMTVHRIINHSMDKKGNYHYLVKWRDL
PYDQSTWEEDEMNIPEYDAHKNSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPTSPTN
DPTVKYENQPRFITATGGTLHLYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLY
SLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDN
AIKGGKKAFKMRREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFF
RVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKL
HDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQV
SLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQG
HRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLST
RAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQ
VAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYD
NEAIARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPD
YWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDE
RPEGRRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFT
SQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMS
LVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASAANSPCTSKPA
TPTPSEKGDETRTPPEKDEADNSEEKLDKDKKGGEKMEAEPDAPSPAPSPGEPRRILLGD
EESGVPGELEAESGSRGDKEKPEEHKGERESRLGPSRDESRSNGRREEKSEKPRFMFNIA
DGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAII
NEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHAR
FAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPTTLSRIPPI
AARLQMSERSILSRLASKGTEPYPTPAFPPGPYATPLGYGAAFSSATPAGVLAGGGANYS
QMPAGSFITAAANGPPVLVKKEKEGAMVSDGQDRKEPRAGEVICIDD
Download sequence
Identical sequences F7ABK0
ENSMODP00000030757 ENSMODP00000030757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]