SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031211 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031211
Domain Number 1 Region: 230-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000143
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 267-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000173
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000173
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 930-980
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000031211
Domain Number - Region: 353-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000125
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 179-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00324
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 85-160
Classification Level Classification E-value
Superfamily SET domain 0.00654
Family Histone lysine methyltransferases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031211   Gene: ENSMODG00000019057   Transcript: ENSMODT00000032780
Sequence length 1224
Comment pep:known_by_projection chromosome:BROADO5:4:388544847:388801160:1 gene:ENSMODG00000019057 transcript:ENSMODT00000032780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPAFSYPYLNLFLMVPQGSCQLPLTLPFVGCYSIANNHIPGGRNLDTIQVWRWRVRKI
SYFSLSLLPSWAGEGGQVVTASLKGTMIGCDTGMFPGIHIADELGNEKFCVEANQTGNGN
WLKYIRVACSRDDQNLAVCQINEQIYYKVIKDIEPGEELLLYMKEGAYSLGAMPPNLEED
RTFRCEECDELFQSKLDLRRHKKYTCTSVNTLYETLNEEIKQEGVSDGQIHECKDCERMF
PNKYSLEQHMIIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPS
NLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLC
RHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYNPGGIFAPALPLTPSSMMD
KSKPSPNLNHAGLGFNDYFPSRPHPGGLPFSTAPPAFPALTPGFPGIFPPSLYPRPPLLP
PTPLLKSPLNHTQDAKLPSPLGNPALPLISAVSNSSQSVSVEEKFEGGLENSYLEKLKAR
NSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDRDKTKDKSKPTESKPDFVSGSV
APGAPNSINEVPVFYSQHSFFPPPEEQLLPTSGAANDSIKAIASIAEKYFGPGFMGMQEK
KMGSLPYHSMFPFQFLPNFPHSLYPFTDRTLNHNLLVKAEPKSPRDLHKVGSTSSESPFD
LTTKPKEMKPILPAPKIVPPAQASGEEQPLDLSIGNRIRASQNGGREPRKNHIYGERKLL
PSEMLPKISPSQLPQQPSLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLIF
HPQVKPVGKGGGMLGNIGERPVDLGPSPQAPHLLFSFYRNFPPWINNPLVCETWAQPEFT
SKLGGKMVGRQKPLGNWRHLQNTSWYVSCRCKYCDRSFSISSNLQRHVRNIHNKEKPFKC
HLCNRCFGQQTNLDRHLKKHEHENVPVSQHTGVITNHLGTSASSPNSESDNHALLDEKED
SYFSEIRNFIANSELNQASTLTDKRPEIQDIDSNSQCHGLANEKSEDVDEEEEELEEEDD
DSLTGKSQDETVSPTTEPQGAYEDEEDEEPTSLSMSFDHTRRCMEEEEAGLLDLEQMPNF
GKGLDLRKAAEEAFEVKDVFNSTLDSEAIKQTLYRQAKNQAYAMMLSLSENAPLHASSQN
SLDAWLNMTGAASETGAFNSINHL
Download sequence
Identical sequences F6RBX7
ENSMODP00000031211 ENSMODP00000031211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]