SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031317 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031317
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-29
Family Canonical RBD 0.0000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031317   Gene: ENSMODG00000003189   Transcript: ENSMODT00000032888
Sequence length 331
Comment pep:known_by_projection chromosome:BROADO5:3:490319750:490347754:1 gene:ENSMODG00000003189 transcript:ENSMODT00000032888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPK
VAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVVHVCVCLQEGRRRHRLGE
VTLKASSPLPTLCLLPFGGRGLQNSSRQTALSTWREVRFPDGSALSMGPRLCQALQGVIR
PHLPTGYPGFQAATYASRSYTGLAPGYTYQFPGKCHGPRCPVPACSRGSSLSLFPLGHPP
PPAKNFCWALFSRLSGSHPWALAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSS
YISAASPAPSTGFGHSLGGPLIATAFNNGYH
Download sequence
Identical sequences F6VEK6
ENSMODP00000031317 ENSMODP00000031317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]