SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031345 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031345
Domain Number 1 Region: 99-592
Classification Level Classification E-value
Superfamily TPR-like 1.33e-58
Family HAT/Suf repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 814-921
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.18e-23
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 3 Region: 713-805
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.2e-19
Family Canonical RBD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031345   Gene: ENSMODG00000002859   Transcript: ENSMODT00000032917
Sequence length 977
Comment pep:known_by_projection chromosome:BROADO5:3:488756155:488789002:1 gene:ENSMODG00000002859 transcript:ENSMODT00000032917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAASGSRAESAAISAAVVAEETENKEAATALAVRAARGRPEHKEHSEDSGGGG
DGVDEDEDDDLGCSSAEDDDDDDDDDEEKENEAEIQRLEEQLSINAFDYNCHVDLIKLLR
QEGELIKLRRARQKMSELFPLTEEIWLDWLKDEIKIASDGSDREKVYELFERAVKDYICP
EIWLEYAQYSIGGIGQEGGIEKVRSIFERALTAVGLHVTKGAAMWEAYREFENAILKTVQ
PTPGRVPTCKQQQTLALQLERIHTLFRRQLGVPLLDMEATYAEYEEWSNDPIPESVMQNY
KKALQQMEKCKPYEEALLVAETPKLAEYQTYIEFELKAGDPARIQLIFERALAENCLVPD
LWARYNQYLDRQLKMKDLVLSAHDRAVRNCPWTVGLWNRYLLAMERHGVAHQIVSDNFEK
ALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSRELEELRAAFARALEYLEQEVEERFS
ESGDPSCTIMQNWARVEARLCNNMQKARELWDSIMTKGNAKYANMWLEYYNLERAHGDTQ
HCRKALHRAVQCTSDYPEHVCEVLLTLERIEGTLEDWDTAVQKTENRLARVNEQRVKAAE
KEAALAQQEEEKTEQRKRARAEKRASKKVKKTKAGDKRKVDEDEEDQWGDEEEEQPCKRP
RAGHNLSLTEEAESMSMELGLFGRSEPTEVDPPSKQKERAAAIRKEMPKVFHDSNKDNIT
VFVSNLPYGLGEPDVKLRPLFEPFGEVTEIRPIFSNRGDFRGYCYVEFKEEKAALQALSL
DRKMVDGRPMFVSPCVDKNKNPDFKVFRYSTALEKHKLFISGLPFSCTKEELEDICKVHG
NVKDLRLVTNRAGKPKGLAYVEYENESQASQAVLKMDGMTIKQNVIKVAISNPPQRKLPD
RPEAGRALGAMVPRQVYGARGKGRTQLSLLPRALQRPNNPGPKTENGTFQTPPGPSSTPT
EAPKMSNADFAKMLLKK
Download sequence
Identical sequences F6UVE9
XP_007490022.1.35504 ENSMODP00000031345 ENSMODP00000031345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]