SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031416 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031416
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.9e-31
Family Canonical RBD 0.00000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031416   Gene: ENSMODG00000011785   Transcript: ENSMODT00000032989
Sequence length 585
Comment pep:novel chromosome:BROADO5:X:79145732:79180207:-1 gene:ENSMODG00000011785 transcript:ENSMODT00000032989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLAVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPIIESPYGDPIS
PEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQANIPSLIQGNPPPGQGPSAPMNQPNAAASQPQPLGGMHVNGAPPLM
QPPLPGGVPAPGAMPTPGPGPGPLAPGGGMPSKVGMPGGGPVSLDRGQGSLQHSPVGPAG
PTPIERVQVPMPDPRAPMQRGPMPAGGPPPRGLLGDAPNDPRGGTLLSVTGEVEPRGYMG
PPHQGPPMHHVPGHDSRGPPHEMRGGPLGEPRPLMGEPRGPMLDQRGPPMDGRGGRDPRG
MDARAMEARAMEARGMDARAMEARGMEARSLESRAMEARGMDARAMETRGPGPRGPMPGG
LQGPGPINMGAGGPQGPRQFLGMGGMVNEIRIQVPGMQGSGLQGGGQPGGFSPGQNQVTP
QDHEKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
Download sequence
Identical sequences F6QNJ2
ENSMODP00000031416 ENSMODP00000031416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]