SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031588 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000031588
Domain Number - Region: 231-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.008
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Domain Number - Region: 152-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00981
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number - Region: 90-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.01
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031588   Gene: ENSMODG00000023776   Transcript: ENSMODT00000033161
Sequence length 357
Comment pep:known_by_projection chromosome:BROADO5:4:383518290:383525660:-1 gene:ENSMODG00000023776 transcript:ENSMODT00000033161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTDGGGDPGPANSLRCPQPSGWIPEHQRASKSSSKGRGSAPRRRGFHPRGSRGAPVLPWG
PGAAGAIGCWCASGAAAPRKSQVIPEVSGDLHLQHTSTDQSGTYHCQDEAGNTRVVYNVD
FQDGTKLYVSHSELNQLPLKNQTVGNNNQWTLFTQWGPWQACNRCGIQGERKRVGLCYAK
RSGQSELPCGLANLSPQGYHRGPELQIEGCFIRCGHSAADSTMVLYGTYQLEEEENSTVW
LSCPFATIYRPVSWESDNTSPTWRQQLSLNKTGLVLDLPSGGSRLQVSISDTYRCYVARK
LVGRFDPAWTHDPPRTLARSEIVRIYSVIEAVMVMAVLLLILLSFIQMCRTKLNTNI
Download sequence
Identical sequences F6RVZ5
ENSMODP00000031588 ENSMODP00000031588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]