SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031611 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031611
Domain Number 1 Region: 17-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000157
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 
Domain Number 2 Region: 235-360
Classification Level Classification E-value
Superfamily SET domain 0.00000425
Family Viral histone H3 Lysine 27 Methyltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031611   Gene: ENSMODG00000023784   Transcript: ENSMODT00000033185
Sequence length 398
Comment pep:known_by_projection chromosome:BROADO5:4:383317023:383351231:-1 gene:ENSMODG00000023784 transcript:ENSMODT00000033185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDSSSDASPEEGSQSQGEDAFKDISTYFSKKQWVKLKEWEKVRLKNVKRNYEAMIKIG
LSVPRPAFMCRGRQNKKVKVEESGDSDEEWIPKQLVKTLRFPSRAKQRTHPKNKAKKPAD
PKAEGMMDLSEELKTVVMNNLTISEEVKKQMDGICTSNQLTEGKLDCRRKDVEVHIYSLR
ERKYQVYQEMWDPQDDDYLYCEECQIFFLDSCPLHGPPTFVQDSAMVKGHPYCSAITLPP
GLRIGLSGIPGAGLGVWNEASTLPLGLHFGPYKGKMTEDDEAANSGYSWMITKGRNCYEY
VDGKEESCSNWMRYVNCARDEEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDEYGQE
LGIKWGSKWKRPLPELTDGETEAQGGKSQRAKTQMQVF
Download sequence
Identical sequences F6WQP0
XP_016277715.1.35504 ENSMODP00000031611 ENSMODP00000031611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]